KEGG   Burkholderia multivorans ATCC BAA-247: NP80_2549Help
Entry
NP80_2549         CDS       T03881                                 

Definition
(GenBank) hypothetical protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
bmul02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmul00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NP80_2549
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bmul02022]
    NP80_2549
Two-component system [BR:bmul02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   NP80_2549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ B12-binding
Motif
Other DBs
NCBI-ProteinID: AJY17705
Position
1:complement(2714695..2715420)
Genome map
AA seq 241 aa AA seqDB search
MTTQILIVDDDQELRDLLRDYLVRQGMEVSVLHDAATLEKRLERERPDLIVLDLMMPGVD
GLTALRQLRASGDDIPVIMLTARADDVDRIVGLELGADDYLGKPFNPRELLARVQAVLRR
RRATPSAAAPEQREPFAFGRFVLDFQARTLSIDGKPATLSSSEFALLKIFVNHALRTLTR
ERLLELLHGPEYDGTDRGIDVQVWRLRRILETDPSTPRFIQTVRGRGYVFVPDGEAHAQT
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgactacccagatcctcatcgtcgacgacgaccaagaactccgcgacctgctgcgcgac
tatctcgtgcgccaggggatggaagtgtccgtgctgcacgacgcggcaacgctcgaaaag
cgcctcgagcgcgagcgccccgacctcatcgtgctcgacctcatgatgccgggcgtggac
ggcctcaccgcgctgcgtcagctgcgcgcgtcgggcgacgacatccccgtgatcatgttg
accgcgcgcgcggacgacgtggaccgcatcgtcgggctcgagctcggcgcggacgattac
ctcggcaagccgttcaatccgcgcgagctgctcgcacgcgtgcaggccgtgctgcgccgc
cgccgcgcgacgccgtcggccgccgcgcccgagcagcgcgagccgttcgcattcggccgc
ttcgtgctcgacttccaggcgcgcacgctgtcgatcgacggcaagccggcgacgctgtcg
agcagcgaattcgcgctgctgaagattttcgtgaaccacgcgctgcgcacgctcacgcgc
gagcggctgctcgagctgctgcacgggcccgagtacgacggtaccgaccgcggcatcgac
gtccaggtgtggcgcctgcgccgcatcctcgagaccgatccgtcgacgccgcgcttcatc
cagacggtccgcgggcgcggctacgtgttcgtgcccgacggcgaggcccatgcgcaaacc
cattga

DBGET integrated database retrieval system