KEGG   Burkholderia multivorans ATCC BAA-247: NP80_3231Help
Entry
NP80_3231         CDS       T03881                                 

Definition
(GenBank) beta-eliminating lyase family protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
bmul00260  Glycine, serine and threonine metabolism
bmul01100  Metabolic pathways
bmul01110  Biosynthesis of secondary metabolites
bmul01120  Microbial metabolism in diverse environments
bmul01130  Biosynthesis of antibiotics
bmul01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmul00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NP80_3231
Enzymes [BR:bmul01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     NP80_3231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AJY15861
Position
2:complement(23123..24136)
Genome map
AA seq 337 aa AA seqDB search
MIDLRSDTVTRPSQAMLAAMTAAEVGDDVWGDDPTVLRLQAATAERAGKEAGLFFPSGTQ
SNLAALMAHCERGDEYIVGQLAHTYKYEGGGAAVLGSIQPQPIENAPDGTLPLAKIAAAI
KPLDNHFARTRLLALENTIGGQVLPEGYVHEAVAFARSRGLSAHLDGARACNAAVASGRS
IAALCAPFDTVSICFSKGLGAPVGSVLVGSRALIERAQRWRKVLGGGMRQSGILAAACLY
ALDHNVERLADDHANAAHLAEGLARIEPVKVLSHATNMVFAQFPEADCAPLEAWLKARGI
LTQMLYASRFVTHCDVSRADIDTFVEAVGAYFAQRRA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgcagcgataccgtgacacgtccgagccaggcgatgctggccgcgatg
actgccgccgaagtcggcgacgacgtatggggcgacgacccgaccgtgctgcgcctgcag
gccgccacggccgagcgggccggcaaggaagccggcctgttcttcccgagcggcacgcag
agcaatctggccgcgctgatggcccattgcgaacgcggcgacgaatacatcgtcggccag
ctcgcgcacacgtacaaatacgaaggcggcggcgccgcggtgctcggcagcatccagccg
cagccgatcgagaacgcacccgacggcacgctgccgctcgcgaagatcgccgccgcgatc
aagccgctcgacaaccatttcgcgcgcacgcgcctgctcgcgctcgagaacacgatcggc
ggccaggtgctgccggaaggctacgtgcacgaagccgtcgcgtttgcgcgcagccgcggc
ttgtccgcacacctcgacggcgcgcgcgcgtgcaacgcggccgtcgcgtcgggccgctcg
atcgccgcgctgtgcgcgccgttcgataccgtgtcgatctgtttctcgaaggggctcggc
gcaccggtcggttcggtgctggtcggcagccgcgcgctgatcgagcgcgcgcaacgctgg
cgcaaggtgctcggcggcgggatgcggcagtcgggcattctcgcggccgcgtgcctgtac
gcgctcgaccacaacgtcgaacgtctcgccgacgatcatgcgaacgccgcgcatctcgcc
gaagggctcgcgcgcatcgaaccggtgaaagtgctgtcgcacgcgacgaacatggtgttc
gcgcagttccccgaagccgattgcgcgccgctcgaggcatggctgaaggcgcgcggaatt
ctgacgcagatgttgtacgcgtcgcgcttcgtcacgcactgcgacgtgtcgcgtgcggac
atcgatacgttcgtcgaagcggtcggtgcgtatttcgcgcagcgtcgcgcgtga

DBGET integrated database retrieval system