KEGG   Burkholderia multivorans ATCC BAA-247: NP80_3846Help
Entry
NP80_3846         CDS       T03881                                 

Definition
(GenBank) polyprenyl synthetase family protein
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
bmul00900  Terpenoid backbone biosynthesis
bmul01100  Metabolic pathways
bmul01110  Biosynthesis of secondary metabolites
bmul01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmul00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NP80_3846
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bmul01006]
    NP80_3846
Enzymes [BR:bmul01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     NP80_3846
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     NP80_3846
Prenyltransferases [BR:bmul01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   NP80_3846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AJY16096
Position
2:725535..726419
Genome map
AA seq 294 aa AA seqDB search
MTFEQWMRSVLDRVEDALGHYLPADTVVPARLHEAMRYAVLGGGKRVRPLLCHAAGELTG
ATEAARNAAAAALEMIHVYSLVHDDMPCMDDDALRRGKPTVHVQYDEPTALLVGDALQSQ
AFVALTDAAALSPVQQAALVRELALASGSLGMAGGQAIDLASVGIKLTREQLETMHRMKT
GALLRAAVRMGALAGETPSADTMAALDVYAGAVGLAFQVVDDILDVTTDSATLGKTAGKD
AANDKPTYVSILGLDASRELAAQLRAEAHDALKPFGARAQRLAELADLVVNRVS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacattcgaacaatggatgcggtccgtgctagaccgcgtcgaggacgcactcggccac
tatctgccggctgacaccgtggtgcccgcacgactccacgaagcgatgcgctatgcggtc
ctcggcggcggcaagcgcgttcgcccgctgctgtgccatgcggcaggcgaactgaccggt
gcgacggaggcggcgcgcaatgcggcggcggcggcgctggagatgatccacgtctactcg
ctcgtgcacgacgacatgccgtgcatggacgacgacgcgctgcgtcgcggcaagccgacc
gtgcacgtgcagtacgacgagccgactgccctgctggtcggcgacgcgctgcagtcgcag
gcgttcgtcgcgctgaccgacgcggctgccctgtcgccggtgcagcaggcggcgctcgtg
cgcgagctcgcgctcgcgagcggctcgctcgggatggcgggcggccaggcgatcgatctc
gcgagcgtcggcatcaagctgacgcgcgagcagctcgaaacgatgcaccggatgaagacg
ggcgcgctgctgcgcgcggcggtgcggatgggcgcgctggccggcgagacgccgtcggcc
gacacgatggctgcactcgacgtctatgcgggggccgtgggtctggccttccaggtcgtc
gacgacattctcgacgtcacgaccgattcggcgacgctcggcaagacggccggcaaggac
gcggcgaacgacaagccgacctacgtatcgatcctcggcctcgatgcgtcgcgcgaactc
gccgcgcagttgcgcgccgaagcgcacgatgcgctgaaaccgttcggcgcacgcgcgcag
cgtctcgccgaacttgccgacctggtagtgaaccgggtcagctga

DBGET integrated database retrieval system