KEGG   Burkholderia multivorans ATCC BAA-247: NP80_3873Help
Entry
NP80_3873         CDS       T03881                                 

Gene name
dmpG
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
bmul00360  Phenylalanine metabolism
bmul00362  Benzoate degradation
bmul00621  Dioxin degradation
bmul00622  Xylene degradation
bmul01100  Metabolic pathways
bmul01120  Microbial metabolism in diverse environments
bmul01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmul00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    NP80_3873 (dmpG)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NP80_3873 (dmpG)
   00622 Xylene degradation
    NP80_3873 (dmpG)
   00621 Dioxin degradation
    NP80_3873 (dmpG)
Enzymes [BR:bmul01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     NP80_3873 (dmpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm Glyco_trans_4_5
Motif
Other DBs
NCBI-ProteinID: AJY15554
Position
2:755008..756051
Genome map
AA seq 347 aa AA seqDB search
MTSAEKKLYISDVTLRDGSHAIRHQYGIDHVRAIAAALDDAGVDSIEVAHGDGLQGSSFN
YGFGAHTDVEWIAAAAESVKRAKIATLLIPGIGTTHDLRQAFDAGARVVRVATHCTEADV
SRQHLDFARELGMDAVGFLMMSHMTTPQKLAEQAKMMETFGATCVYVVDSGGALGMNEIR
DRFRALKAVLKADTQTGMHAHHNLSLGVANSLVAVEEGCDRIDASLAGMGAGAGNAPLEV
FIAAAQRQGWNHGCDLYRLMDAADDLVRPLQDRPVRVDRETLALGFAGVYSSFLRHAEVA
ASKYGLKTVDILVELGRRKMVGGQEDMIVDVALDLLKRRQPATSDAQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagcagaaaagaagctttacatctcggacgtgacgctgcgcgacggcagccat
gcgatccgtcatcaatacggcatcgaccatgtcagggcgattgccgcagcgctcgacgat
gccggcgtcgacagcatcgaggtcgctcacggcgatggcctccagggatcgagcttcaac
tacggattcggcgcccataccgacgtcgagtggattgcagccgctgcggaaagcgtcaag
cgggcgaagatcgccacgctgctgattcccggcatcggaaccacccatgatctacggcag
gcgttcgatgcaggcgcacgcgtcgtgcgcgtggcaacgcattgcacggaagccgatgta
tcgcgccagcatctcgactttgcgcgcgaactcggtatggacgcggtgggttttctgatg
atgagccacatgacgaccccgcagaagctcgctgagcaggcgaaaatgatggaaacgttc
ggcgccacctgcgtttatgtggtcgattccggtggtgcgctcggcatgaacgagatccgc
gacaggttccgtgccctcaaagcggtattgaaagccgacacgcaaaccggaatgcacgcg
catcacaacctgagcctcggcgtggccaactcgctggttgccgtggaggagggatgcgat
cgcatcgatgcgagcctggccggcatgggcgcaggcgcgggcaatgcgccgctcgaagta
ttcattgcggcggcacagcgacagggctggaatcatggctgcgatttgtaccggctcatg
gacgcggccgacgatcttgtccggccgcttcaggatcggccggtacgtgtcgaccgcgaa
acgcttgcgctcggtttcgccggcgtttattcgagcttcctgcgtcatgcggaagtcgcc
gccagcaaatacgggctgaagaccgtcgacattctggtcgaactgggcagacgcaagatg
gtcggcggccaggaagacatgatcgtcgatgtcgcgctggatctgttaaagcggcgacag
ccggccacgagcgatgcgcagtga

DBGET integrated database retrieval system