KEGG   Burkholderia multivorans ATCC BAA-247: NP80_4165Help
Entry
NP80_4165         CDS       T03881                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
bmul00040  Pentose and glucuronate interconversions
bmul00053  Ascorbate and aldarate metabolism
bmul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NP80_4165
   00053 Ascorbate and aldarate metabolism
    NP80_4165
Enzymes [BR:bmul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     NP80_4165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJY15806
Position
2:complement(1096800..1098392)
Genome map
AA seq 530 aa AA seqDB search
MQLTGQLLIGRSAVAGQNGTFHAIAAATGEPLEPAFGGASLQDLETACALADDAFDLYRE
TSLDARAAFLDAIGRNIMALGDALIERCVAESGLPRARVEGERGRTVGQLALFASLVRDG
GFLDARIDPARPDRKPLPRVDLRLRNVAIGPVAVFGASNFPLAFSVAGGDTASALAAGCP
VIVKAHSAHPGTSELVGRAIQQAVQECGLPAGVFSLLFDASREIGQALVADPRIKAVGFT
GSRGGGVALMHIAAARHEPIPVYAEMSSINPVLLLPAALDARHDAIAQQFVASLTLGAGQ
FCTNPGLVLAVDGPALRAFEAAAASAVRAAAAQTMLTPHIHASYARGVAALSDHEAVESL
AQGAEGGRHQARAALFATSADAFMAHRALRDEVFGPASLIVRCPDAETLHRVLKSLEGQL
TIAAHLADGDAPLFAALRATLERKAGRILVNGFGTGVEVGHAMVHGGPFPATSDTRTTSV
GARAIERFLRPVSYQDVPDALLPDAIRDANPLNVPQRIDGVPMPREARNG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcacaggtcagctgttgatcggccggtcggccgtcgccggacagaacggcacc
ttccacgcgatcgccgccgcaacgggcgaaccgctcgaaccggcgttcggcggcgcaagc
ctgcaggacctcgagacggcctgcgcgctcgccgacgacgccttcgacctctatcgcgaa
acgagcctcgacgcgcgcgccgcgtttctcgacgcgatcggccgcaacatcatggcgctc
ggcgatgcactgatcgaacgctgcgtcgccgaatcggggctgccgcgcgcacgcgtcgag
ggcgaacgcggccgcacggtcggccagcttgcgctgttcgcgtcgctcgtgcgcgacggc
ggctttctcgacgcgcgcatcgatcccgcgcgccccgatcgcaagccgctgccgcgcgtc
gatctgcgcctgcgcaatgtcgcgatcgggccggttgcagtcttcggcgcgtcgaacttc
ccgctcgcgttttcggtcgccggcggcgataccgcatcggcgctggccgccggctgcccc
gtcatcgtcaaggcgcactccgcgcaccccggcacgtcggaactggtcggccgtgcgatc
cagcaagccgtgcaggaatgcggtctgccggccggcgtgttctcgctgctgttcgacgcg
tcgcgcgaaatcggtcaggcgctcgtcgccgatccgcgcatcaaggccgtcggcttcacc
ggctcgcgcggcggcggcgtcgcgctgatgcatatcgcggccgcgcgccacgagccgatc
cccgtctacgcggaaatgagctcgatcaatccggtgctgctgttgccggccgcgctcgat
gcgcgacacgatgcgatcgcgcagcagttcgtcgcgtcgctgacgctcggcgccggtcag
ttctgcacaaatccgggcctcgtgctcgcggtcgacggccccgcgctgcgggcattcgaa
gcggccgccgcgagcgccgttcgcgcggccgccgcgcagacgatgctgacgccgcacatc
cacgcgagctacgcgcgcggcgtcgccgcgctgagcgaccacgaagcggtcgaatcgctc
gcgcaaggcgccgaaggcggccgtcatcaggcgcgcgccgcattgttcgccacgtcggcc
gacgcgttcatggcacaccgcgcgctgcgcgacgaggtgttcggccccgcgtcgctgatc
gtccgctgcccggacgccgaaacgctgcatcgcgtgctcaagtcgctcgaaggccagctg
acgatcgccgcgcacctcgccgacggcgacgcgccgctgttcgccgcgctgcgcgcgacg
ctcgagcgcaaggccgggcgcatactcgtcaacggtttcggcaccggcgtcgaagtcggg
cacgcgatggtgcacggcggtccgttcccggcgacgtccgacacgcgcacgacgtcggtc
ggcgcacgcgcgatcgagcgctttctgcgccccgtctcgtaccaggacgtgccggacgcg
ctgctgcccgacgcgatccgcgatgcgaatccgctgaacgtgccgcaacgcatcgatggc
gtgccgatgccgcgcgaggcgcgcaatggctga

DBGET integrated database retrieval system