KEGG   Burkholderia multivorans ATCC BAA-247: NP80_4483Help
Entry
NP80_4483         CDS       T03881                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
bmul00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bmul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NP80_4483
Enzymes [BR:bmul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NP80_4483
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NP80_4483
    1.1.1.-  
     NP80_4483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C DAO UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AJY15640
Position
2:1478011..1479072
Genome map
AA seq 353 aa AA seqDB search
MKAAVWRGRRDIRVEEVPVPERPPAGWVKIRVHWCGICGSDLHEYVAGPVFIPVDAPHPL
TGLKGQCILGHEFSGEIAELGDGVTGFAIGDRVTADACQHCGTCWYCTHGLYNICENLAF
TGLMNNGAFAEYVNVPAELLYRLPDGFPTEAGALIEPLAVGLHAVKKAGSIVGQTVVVVG
AGTIGLCTIMCAKAAGAGRVIALEMSDARKAKALEVGASVVIDPKTSDAIAEVKALTGGY
GADVSFECIGHTTTAKLAIDVIRKAGKSVMVGIFEEPAPFNFFDIVSTEKEVIGSLAYNG
EFADVIRFIADGRIDVQPLITGRIALGDIVARGFEELVHHKDRNVKIIVQPAT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccgtgtggcgcggccgccgcgacatccgcgtcgaagaggttcccgtgccc
gagcggccgccggccggctgggtgaagatccgcgtgcactggtgcgggatctgcggctcg
gacctgcacgaatacgtcgccggccccgtattcattccggtcgacgcgccgcacccgctg
acgggcctgaaaggtcagtgcatcctcggtcacgagttcagcggcgagatcgccgagctc
ggcgacggcgtgacgggcttcgcgatcggcgaccgcgtgactgccgacgcctgccagcat
tgcggcacctgctggtactgcacacacgggctctacaacatctgcgaaaacctcgcgttc
accggactgatgaacaacggcgcgttcgccgaatacgtcaacgtgcccgccgaactgctg
taccggctgcccgacggcttcccgaccgaggccggcgcgctgatcgagccgctcgcggtc
gggctgcacgcggtgaagaaggccggcagcatcgtcgggcagaccgtcgtcgtagtcggc
gcgggcacgatcgggctgtgcacgatcatgtgcgcgaaggcagccggcgcgggccgcgtg
atcgcgctcgagatgtccgacgcgcgcaaggcgaaggcgctcgaagtcggcgcgagcgtc
gtcatcgatccgaagacctcggacgcgatcgccgaggtgaaggcgctgacgggcggctac
ggcgccgacgtgtcgttcgaatgcatcggccacacgacgacggcgaagctcgcgatcgac
gtgatccgcaaggccggcaagtcggtgatggtcgggatcttcgaggagccggcgccgttc
aacttcttcgacatcgtgtcgaccgagaaggaagtgatcggctcgctggcctacaacggc
gagttcgcggacgtgatccgcttcatcgccgacggccggatcgacgtgcagccgctgatc
accggccgcatcgcgctcggcgacatcgtcgcgcgcggcttcgaggaactcgtccatcac
aaggaccgcaacgtgaagatcatcgtgcagccggcgacgtag

DBGET integrated database retrieval system