KEGG   Burkholderia multivorans ATCC BAA-247: NP80_4660Help
Entry
NP80_4660         CDS       T03881                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
bmul00740  Riboflavin metabolism
bmul00790  Folate biosynthesis
bmul01100  Metabolic pathways
bmul01110  Biosynthesis of secondary metabolites
bmul02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bmul00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NP80_4660 (ribA)
   00790 Folate biosynthesis
    NP80_4660 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NP80_4660 (ribA)
Enzymes [BR:bmul01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     NP80_4660 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AJY16107
Position
2:complement(1688558..1689208)
Genome map
AA seq 216 aa AA seqDB search
MMSSRPQSPAPGNGHADECVTLVATASLPTRYGTFTSYAFRVSGSDAEHLALVMGDVTGE
QSVLTRLHSECLTGDVFGSYRCDCGEQLDLALRYVAAEGRGVLLYLRGHEGRGIGLSNKI
RAYALQEQGRDTVEANLDLGLPDDAREYDSAAAILRMLGVTSVRLMSNNPKKFDTLVKHG
IPVCERVALAVPVREENERYIRTKQVKFGHYFEENE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcttcgcgtccccaatcgcccgcgccgggcaatggccacgccgacgagtgcgtg
acgctcgttgccaccgcgtcgctgcccacgcgctacggtacgttcacgtcttacgcgttt
cgcgtatcgggcagcgatgccgaacatctcgcgctggtgatgggcgacgtgaccggcgag
cagtccgtgctgacgcggctgcattccgaatgcctcaccggcgacgtgttcggctcgtat
cgttgcgattgcggcgaacagctcgatctggcattgcgctacgtcgcggccgaagggcgc
ggcgtgctgctgtatctgcgcggccacgaggggcgcggcattggccttagcaacaagatc
cgcgcatatgcgctgcaggagcaggggcgcgacaccgtcgaggcgaacctcgacctcggg
ctgccggacgatgcgcgcgaatacgattcggccgccgcgattcttcgtatgctcggcgtg
acgtcggtgcgcctgatgagcaacaacccgaagaaattcgacacgctcgtgaagcacggc
attcccgtttgcgaacgcgtcgcgctcgcggtaccggtgcgcgaggaaaacgagcgctat
atccggaccaagcaggtgaagttcgggcattacttcgaggaaaacgagtag

DBGET integrated database retrieval system