KEGG   Burkholderia multivorans ATCC BAA-247: NP80_4998Help
Entry
NP80_4998         CDS       T03881                                 

Gene name
fdhA
Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
bmul00625  Chloroalkane and chloroalkene degradation
bmul00680  Methane metabolism
bmul01100  Metabolic pathways
bmul01120  Microbial metabolism in diverse environments
bmul01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmul00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    NP80_4998 (fdhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NP80_4998 (fdhA)
Enzymes [BR:bmul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     NP80_4998 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP FAD_binding_3 XdhC_C 2-Hacid_dh_C YtfJ_HI0045 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AJY16836
Position
2:complement(2091684..2092880)
Genome map
AA seq 398 aa AA seqDB search
MSSNRGVVYLGPGKVEVQKIDYPKMVDPSGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVVEVGRDVETLKIGDLVSVPFNVACGRCAMCKETHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDQAMAKIRDLTCLSDILPTGYHGAV
SAGVKPGSTVYIAGAGPVGMAAAASARLLGAAVTIVGDMNAERLAHAKAMGFETVDLSKD
ATLGEQIAQILGKPEIDCAVDCVGFEAHGHGSSGHAEEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAQDKAAQHGSLSIRFGLGWAKSHSFFTGQTPVLKYNRNLMQAILYDRLPIA
KIVNVTVISLDDAPEGYKKFDGGAPRKFVIDPHGLLAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgaggtgtcgtctatcttgggccgggcaaggtcgaggtgcagaagatc
gattatccgaagatggtcgacccgagcggccgcgcaatcggacacggcgtgatcctgaag
gtcgtcagcacgaacatctgcggctcggaccagcacatggtgcgcggccgcacgacggcg
ccggtcggtctcgtgctcggtcacgagatcacgggcgaggtcgtcgaggtcggccgcgac
gtcgagacgctgaagatcggcgatctcgtgtcggtgccgttcaacgtcgcgtgcggccgc
tgcgcgatgtgcaaggaaacgcatacgggcgtctgcctgaacgtgaacccgtcgcgcgcg
ggcggcgcgtacggctacgtcgacatgggcggctggatcggcggccaggccgaatacgtg
ctcgtgccgtatgccgacttcaacctgctgaaattcccggaccgcgatcaggcgatggcg
aagatccgcgatctgacctgcctgtccgacattctgccgaccggttatcacggcgcggtc
agcgccggcgtgaagccgggttcgaccgtctacatcgcgggcgcgggcccggtcgggatg
gcggcggccgcctcggcgcgcctgctcggcgcggccgtgacgatcgtcggcgacatgaac
gcggaacgcctcgcgcatgcgaaggcgatgggcttcgagacggtcgacctgtcgaaggac
gcgacgctcggcgaacagatcgcgcagatcctcggcaagccggagatcgactgcgcggtc
gactgcgtcggcttcgaggcgcacggccacggctcgtcgggccatgctgaggaagcgccc
gcgacggtgctgaactcgctgatggaaatcacgcggccggccggtgcgatcggcatcccg
ggcctgtacgtgacggacgatccgggcgcgcaggacaaggccgcgcagcacggcagcctg
agcatccgcttcggtctcggctgggcgaagtcgcattcgttcttcacgggccagacgccg
gtgctgaagtacaaccgcaacctgatgcaggcgatcctgtacgaccgcctgccgatcgcg
aagatcgtcaacgtgacggtgatctcgctcgacgacgcgcccgaaggctacaagaagttc
gacggcggcgcgccgcgcaaattcgtgatcgatccgcacgggctgctcgcggcctga

DBGET integrated database retrieval system