KEGG   Burkholderia multivorans ATCC BAA-247: NP80_575Help
Entry
NP80_575          CDS       T03881                                 

Gene name
pcaF
Definition
(GenBank) 3-oxoadipyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
bmul00071  Fatty acid degradation
bmul00072  Synthesis and degradation of ketone bodies
bmul00280  Valine, leucine and isoleucine degradation
bmul00310  Lysine degradation
bmul00362  Benzoate degradation
bmul00380  Tryptophan metabolism
bmul00620  Pyruvate metabolism
bmul00630  Glyoxylate and dicarboxylate metabolism
bmul00640  Propanoate metabolism
bmul00650  Butanoate metabolism
bmul00900  Terpenoid backbone biosynthesis
bmul01100  Metabolic pathways
bmul01110  Biosynthesis of secondary metabolites
bmul01120  Microbial metabolism in diverse environments
bmul01130  Biosynthesis of antibiotics
bmul01200  Carbon metabolism
bmul01212  Fatty acid metabolism
bmul02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NP80_575 (pcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    NP80_575 (pcaF)
   00640 Propanoate metabolism
    NP80_575 (pcaF)
   00650 Butanoate metabolism
    NP80_575 (pcaF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NP80_575 (pcaF)
   00072 Synthesis and degradation of ketone bodies
    NP80_575 (pcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NP80_575 (pcaF)
   00310 Lysine degradation
    NP80_575 (pcaF)
   00380 Tryptophan metabolism
    NP80_575 (pcaF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NP80_575 (pcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NP80_575 (pcaF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NP80_575 (pcaF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmul04147]
    NP80_575 (pcaF)
Enzymes [BR:bmul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NP80_575 (pcaF)
Exosome [BR:bmul04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NP80_575 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Phage_lysis
Motif
Other DBs
NCBI-ProteinID: AJY18670
Position
1:complement(604845..606047)
Genome map
AA seq 400 aa AA seqDB search
MTDAYICDAIRTPIGRYGGALKDVRADDLGAVPLKALIERNRDVDWNAVDDVIYGCANQA
GEDNRNVARMSALLAGLPTAVPGATLNRLCGSGMDAIGTAARAIKAGEARLMIAGGVESM
TRAPFVMGKAASAFARQADIYDTTIGWRFVNPLMKQQYGVDSMPETAENVAVDYNVSRAD
QDLFALRSQQKAARAQQDGTLAEEIVPVTIAQKKGDPLVVSRDEHPRETSLEALAKLKGV
VRPDGTVTAGNASGVNDGACALLLANAEAADQYGLRRRARVIGMATAGVAPRVMGIGPAP
ATQKLLQQLGMTIDQFDVIELNEAFASQGLAVLRMLGVADDDPRVNPNGGAIALGHPLGA
SGARLVTTAMYQLHRTNGRFALCTMCIGVGQGIALAIERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgcctatatctgcgatgccattcgcacccctatcggccgctacggcggcgcc
ctgaaagacgtccgcgcggacgacctcggcgcggtgccgctgaaggcgctgatcgagcgc
aaccgcgacgtcgactggaacgcggtcgacgacgtgatttacggctgcgcgaaccaagcc
ggcgaagacaaccgcaacgtcgcgcgcatgtcggcgctgctggccgggctgccgaccgcc
gtccccggtgcgacgctgaaccggctctgcggctcgggcatggacgcgatcggcacggcc
gcgcgcgcgatcaaggccggcgaagcgcggctgatgatcgccggcggagtcgaaagcatg
acgcgcgcgccgttcgtgatgggcaaggccgcgagcgcattcgcgcgtcaggccgacatc
tacgacacgacgatcggctggcgtttcgtcaatccgctgatgaaacagcaatacggcgtc
gactcgatgccggagacggccgagaacgtcgcggtcgactacaacgtgagccgcgccgat
caggatctgttcgcgctgcgcagccagcagaaggcggcccgcgcgcagcaggacggcaca
ctggccgaggaaatcgtgcccgtcacgattgcgcagaagaagggcgacccgctcgtcgtg
tcgcgcgacgagcatccgcgcgaaacgtcgctcgaagcgctcgcgaagctgaagggcgtc
gtgcgcccggacggtacggtgacggccggaaacgcgtcgggcgtcaacgacggcgcgtgc
gcgctgctgctcgcgaatgccgaagcggccgaccagtacggcctgcgccgccgcgcgcgc
gtcatcggcatggcgaccgccggcgtcgcgccgcgcgtgatgggcatcggcccggcgccg
gccacgcagaagctgctgcagcaactcggcatgacgatcgatcagttcgacgtgatcgag
ctgaacgaagcgttcgcgtcgcagggcctcgcggtgctgcgcatgctcggcgtcgccgac
gacgatccgcgcgtgaacccgaacggcggcgcgatcgcactcggccatccgctcggcgcg
tcgggcgcgcggctcgtgacgacggcgatgtatcagctgcatcgcacgaacggccgcttc
gcgctctgcacgatgtgcatcggcgtcgggcaaggcatcgcgctcgcgatcgaacgcgta
tag

DBGET integrated database retrieval system