KEGG   Bacillus muralis: ABE28_003035Help
Entry
ABE28_003035      CDS       T05340                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bmur  Bacillus muralis
Pathway
bmur00030  Pentose phosphate pathway
bmur01100  Metabolic pathways
bmur01120  Microbial metabolism in diverse environments
bmur01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ABE28_003035
Enzymes [BR:bmur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     ABE28_003035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR THF_DHG_CYH_C Epimerase DSBA
Motif
Other DBs
NCBI-ProteinID: AOH53313
UniProt: A0A1B3XJC2
Position
complement(641938..642723)
Genome map
AA seq 261 aa AA seqDB search
MYKDLEKKVVVITGAAKGLGKAMAERFGKEKAHVVLNYHTENDDHKDIIKTIEAAGGKAA
AIQGDVSKEADIKKLLSFAVDTFGTVDIMINNAGIENEVPSEKLTLEDWQRVIDVNLTGM
FLASREAISYMLDHDIKGNIINMSSVHDRIPWPHFVHYAASKGGVKMMTETLALEYAPKG
IRINNISPGAIDTPINAEKFNDPKAKQEVIDLIPMGYIGKPEQIAACAAWLASAESSYVT
GLTLYADGGMTKYPGFQAGKG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagatttagagaaaaaagtggtcgtcatcaccggagcggcaaaagggctagga
aaagccatggccgaaaggttcggtaaggaaaaggcacatgtagtgctgaactatcacact
gaaaatgacgatcataaggatatcatcaaaacgatcgaagcagccgggggcaaagcggcg
gccatccaaggcgacgtttcaaaggaagcggatattaagaaactgctttcattcgcggtc
gatacgttcggcacagtcgacatcatgatcaacaatgccgggattgaaaatgaagtgcca
agtgaaaaattgacacttgaggattggcagagggtcattgatgtaaatctaaccgggatg
ttcctggcaagcagggaagcgatcagctatatgctagaccatgacattaaggggaatatc
ataaacatgtcctccgttcatgatcgaatcccttggcctcattttgttcactatgcagct
agtaaaggcggagtgaagatgatgaccgaaacccttgcacttgagtacgcccctaaaggg
attcgcatcaataacatatcccctggcgcaatcgacacgcccatcaatgccgaaaagttc
aatgacccaaaagcgaaacaagaggtcatcgacttaattccaatgggatatatcggtaaa
ccggaacagattgccgcttgtgctgcttggctagcctcagctgaatcaagttacgtaacg
ggcttgaccttatacgctgatggcggaatgacgaaatatcctggattccaagcaggaaaa
ggctga

DBGET integrated database retrieval system