KEGG   Bacillus muralis: ABE28_008180Help
Entry
ABE28_008180      CDS       T05340                                 

Definition
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
bmur  Bacillus muralis
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bmur03016]
    ABE28_008180
Enzymes [BR:bmur01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     ABE28_008180
Transfer RNA biogenesis [BR:bmur03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    ABE28_008180
 Prokaryotic Type
    ABE28_008180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2
Motif
Other DBs
NCBI-ProteinID: AOH54330
UniProt: A0A1B3XM85
Position
1694478..1695398
Genome map
AA seq 306 aa AA seqDB search
MNGILPLWKPKGMTSHDCVFKLRKILKTKKVGHTGTLDPDVTGVLPICIGRATKIAEYLT
EAGKAYEGEVTLGFSTTTEDASGERVEEQTIGEVIPRERILEVLESLTGKIEQTPPMFSA
VKVNGKKLYEYARAGIEVERPTREVTIYEITLLDDRTEFMGETISFRFRVKCSKGTYIRT
LAVMMGDKLGIPAHMSDLTRIESAGFKLDDCFTFAEVEAFMETGQTDVFLLPLERGLFHL
PKFKINDKVARKVLNGAVLEQTGDVTAEKGVPFVMVDPSDKAIAIYQVHPTKEGLIKPVK
VLAQES
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcattcttccattgtggaaaccaaagggaatgacatcccatgattgtgttttt
aaattgagaaagatattgaaaacaaaaaaggttgggcatacagggacactggatcctgat
gtgacaggggttttacccatttgtataggcagggcaacgaaaattgccgagtatttaaca
gaagcaggcaaggcatacgaaggagaagtgactctcggtttttccacgacaaccgaggat
gcaagcggtgaaagagtcgaggagcaaacgattggtgaagtgattcctcgtgaacggata
ctggaagtgctggaatcactgacagggaaaatcgaacaaacgccgccgatgttttcagct
gttaaggtgaacgggaagaaattatatgaatatgcccgtgctggtatcgaggtggagaga
ccgacaagagaggttaccatttacgaaattacccttctcgatgatcgcaccgaattcatg
ggagaaacgatttcttttcgctttcgggtcaagtgcagcaagggtacgtatatcaggacg
cttgccgtcatgatgggtgataagcttggcatacctgcccatatgtcagacttgaccagg
attgaatcggcaggcttcaagctagatgactgctttacgtttgctgaggtggaagcattc
atggaaacgggacaaacggatgtttttcttttgccattagagcggggattatttcatttg
cccaaatttaagattaatgataaagtagcaaggaaagtacttaacggtgcggtattggag
caaacaggggatgtgactgccgaaaaaggggtgccttttgtgatggtagatccatctgat
aaggcaattgccatttatcaagtacatccgacaaaagaaggattaattaaacctgtaaaa
gtattggcacaagaatcatag

DBGET integrated database retrieval system