KEGG   Bacillus muralis: ABE28_012120Help
Entry
ABE28_012120      CDS       T05340                                 

Definition
(GenBank) D-serine ammonia-lyase
  KO
K01753  D-serine dehydratase [EC:4.3.1.18]
Organism
bmur  Bacillus muralis
Pathway
bmur00260  Glycine, serine and threonine metabolism
bmur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABE28_012120
Enzymes [BR:bmur01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.18  D-serine ammonia-lyase
     ABE28_012120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AOH55096
UniProt: A0A1B3XPG2
Position
complement(2492237..2493568)
Genome map
AA seq 443 aa AA seqDB search
MKTIAGLSILEWQGKHQLLNNLIQMDEVFWINPDYGTELDETIVQADHVKSAEDRLGRFA
DYIVEAFPETRTMQGIIESPLVEIPSMQKNMEKSYNVEITGKLLLKCDSHLPISGSIKAR
GGIYEVLKRAEEIAMKHGGLKQTDDYGILASDTYKELFSNYSIAVGSTGNLGMSIGIISA
KLGFRVTVHMSGDAKQWKKDKLTSLGVIVKEYDDDYSKAVEEGRVEASLDPNCHFIDDED
SMDLFLGYATAAERLKNQLKHRSIRVDEEHPLFVYLPCGVGGGPGGITYGLKLAFGEHVH
CFFAEPTHSPCMTIGLMTGLHDKVSVQEFGIDNKTEADGLAVGRPSGLVSGLMTAILSGS
YTIEDKRLFELLGQMAETEGYYLEPSALAGAYGPVHLMSDPTGQKYLDDHKLLGKMNDAT
HIIWATGGSMVPKDMMEQYLAKR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatcgcaggtttgtcaatattggagtggcaagggaagcatcaattacttaat
aatttgattcaaatggatgaagtgttctggattaatccagattacggtactgagttggac
gaaacgatcgtccaagcggaccacgttaaatcggcagaagacaggttgggaagatttgct
gattatatcgtcgaggcatttcctgaaacaaggactatgcaggggattattgaatcacca
ctagtggaaattccctccatgcaaaaaaacatggaaaaatcctataacgttgaaataacg
gggaaactcttgcttaaatgcgacagtcacttgcccatatccggctctatcaaggcgcgc
ggaggcatttatgaagtcttgaagcgtgctgaggaaattgccatgaagcatggcggatta
aagcaaacggatgattatggaatccttgcaagcgatacatacaaggaattattttcaaac
tactcgatagccgtcggatcaaccggaaatttaggcatgagcatcggcatcatcagcgca
aagctgggcttccgggttaccgtccatatgtcaggcgatgcgaagcagtggaaaaaggat
aagctaacaagcctgggtgtcattgtaaaggaatatgatgatgactatagtaaggctgtg
gaagaagggcgggtggaagcctctcttgaccccaattgccatttcattgatgatgaagat
tcgatggacttgtttctcggttacgcgacggctgctgagcgcctgaagaatcaattgaag
catcgctcgatacgcgttgatgaagagcatcctttgtttgtatacctgccttgcggagtg
gggggcggtcccggtggcatcacttatggcctgaagcttgctttcggtgaacatgtccat
tgcttttttgcagagccgacgcattcgccatgtatgactataggattaatgacaggactt
catgacaaagtctcggtgcaggaatttggaatcgacaataaaacggaagcggatggactc
gccgtcggaaggccatccggcttagtttccggtttaatgactgccattctaagcggtagc
tataccatagaagataagcgattatttgaattgctcgggcagatggcagagacagaaggg
tactatttagagccatccgccctggcaggagcatatggacccgtacaccttatgtcggat
ccaacagggcaaaaataccttgacgatcataaactactagggaaaatgaacgacgccacg
catatcatctgggcgacaggcgggagcatggtgccaaaggacatgatggaacaatattta
gctaaacggtaa

DBGET integrated database retrieval system