KEGG   Bacillus muralis: ABE28_018080Help
Entry
ABE28_018080      CDS       T05340                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
bmur  Bacillus muralis
Pathway
bmur00051  Fructose and mannose metabolism
bmur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ABE28_018080
Enzymes [BR:bmur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     ABE28_018080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N 3HCDH_N Sacchrp_dh_NADP ApbA PglD_N Flp_C Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AOH56277
UniProt: A0A1B3XST6
Position
complement(3720112..3721257)
Genome map
AA seq 381 aa AA seqDB search
MKQVVHFGAGNIGRGFIGALFSQSGYHVTFVDIAEKIIDQLNEKKQYQVKLATDQQESVT
VENVSGLNSLNQEAEIIKAISEATYLTTAIGPNILPHIAPLMAKGLASRVKRTDEKLYVI
ACENQISATDLLEGYILQHLDQETKASLADKVYFFNSAVDRIVPLQNNEGSLDVLVEPYY
EWVVETNESIPAVEGMTIVKELAPFIERKLFTVNTGHASIAYLGYLKDSKLTIDQSLEDE
AIVEQVKKILGETGAYLIKQYGLDADEHQRYIEKIIARFKNAYLNDSVNRVGRSPLRKLG
PNDRLVRPAVEAKKAGLTYSNLAKAIASALLFDFPEDEEAIKLQAMIKEKGVPAVLKEVS
GLDENSEITKEVITHYNEMKK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagtcgtacatttcggtgcaggaaacattggaagaggatttatcggagcactc
ttttcacaatctggatatcatgtcacatttgtagatatagctgaaaaaatcatcgatcaa
ttgaatgaaaaaaaacaataccaagtgaaactggcaaccgatcaacaagaatcggtcacg
gttgaaaacgtttcaggcttaaatagcttgaaccaggaagcggaaatcataaaagccatt
tcggaagcaacctaccttaccacggcaatcggaccgaatatcttgcctcatatcgctcct
ttgatggcaaagggattggcttcaagagtgaaacgaaccgatgaaaagctgtatgtgatc
gcttgcgaaaaccaaatctcggcaacagaccttttggaagggtacatcctgcaacacttg
gatcaagaaacgaaggctagtttggctgataaagtatacttcttcaattcagcagtcgat
cggatcgtcccgttgcaaaataacgaagggtcactggacgtattggttgaaccttattat
gaatgggtcgttgaaacgaatgaaagcattcctgcggtcgaagggatgacgatcgtaaaa
gaactggctccattcatcgagaggaaactgttcaccgttaatacaggacatgcttcgatc
gcgtacctcggttatcttaaagacagcaaattgacaattgaccaatccctggaggatgaa
gcgattgtcgagcaagtcaagaaaatactcggggaaacgggcgcctatttaataaagcaa
tacggtttggatgcagacgagcatcagcgctatattgaaaaaatcattgcccgatttaaa
aacgcctacttgaacgattcggtgaatagggtgggccgttcaccgctccgcaagcttggg
ccgaacgaccgtctcgtacgacctgccgttgaagcgaagaaggccggtctaacttattcg
aacttggcgaaggcgatagcatccgcattgctgtttgatttccccgaagacgaagaagcg
atcaagctgcaagcgatgatcaaagaaaagggtgtaccagccgtacttaaggaagttagc
ggcttggacgaaaacagtgaaataacgaaagaagtcatcactcattacaatgaaatgaaa
aaatga

DBGET integrated database retrieval system