KEGG   Bacillus muralis: ABE28_018495Help
Entry
ABE28_018495      CDS       T05340                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
bmur  Bacillus muralis
Pathway
bmur00072  Synthesis and degradation of ketone bodies
bmur00280  Valine, leucine and isoleucine degradation
bmur00650  Butanoate metabolism
bmur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ABE28_018495
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    ABE28_018495
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABE28_018495
Enzymes [BR:bmur01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     ABE28_018495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AOH56360
UniProt: A0A1B3XT23
Position
complement(3811385..3812032)
Genome map
AA seq 215 aa AA seqDB search
MTRQLILERAVKEIQDGMCVNLGIGMPTLIANMIPNDFNVMLQSENGLLGIGPYPQKDEV
DPDLINAGKETVTAKAGASFFDSAESFAMIRGGHIDLAILGGMEVSEAGDLANWMIPGKM
VKGMGGAMDLVQGAKRIVVIMDHVNKHGESKVKKSCTLPLTGEKVVHCLITELAVFHFSE
VGMELIELQNGVTLDEVKSKTEADFTISPSIEIKA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgactagacaactgattttagaacgggccgtgaaagaaatccaagatggtatgtgtgtg
aatttaggaatcgggatgccgaccttgattgccaacatgattcccaatgactttaatgtc
atgcttcaatcggaaaatggcttacttggtatcggaccttatccacaaaaggatgaagtc
gatccggatttgatcaacgcagggaaagaaacggtaacggccaaagccggggcatcattt
tttgatagcgctgaatcgtttgcaatgattcgcggcggccacatcgaccttgccatttta
ggcgggatggaggtttccgaagcgggggacttggccaactggatgattccagggaagatg
gtaaaaggaatgggaggtgcgatggacctcgtccagggagctaaacgcatcgttgtcata
atggaccatgtgaacaagcatggggaatccaaagtgaaaaagagctgtacactgccgttg
acaggagaaaaggtcgtccattgcctcattaccgaattggctgttttccatttttccgaa
gtgggcatggaactgattgaattgcaaaatggcgtaacgcttgatgaagtgaagagtaaa
acagaggctgatttcaccataagcccttctattgaaattaaggcataa

DBGET integrated database retrieval system