KEGG   Bacillus muralis: ABE28_020660Help
Entry
ABE28_020660      CDS       T05340                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
bmur  Bacillus muralis
Pathway
bmur00010  Glycolysis / Gluconeogenesis
bmur00020  Citrate cycle (TCA cycle)
bmur00620  Pyruvate metabolism
bmur01100  Metabolic pathways
bmur01110  Biosynthesis of secondary metabolites
bmur01120  Microbial metabolism in diverse environments
bmur01130  Biosynthesis of antibiotics
bmur01200  Carbon metabolism
Module
bmur_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABE28_020660
   00020 Citrate cycle (TCA cycle)
    ABE28_020660
   00620 Pyruvate metabolism
    ABE28_020660
Enzymes [BR:bmur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     ABE28_020660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_16 AAA_24 AAA_33 RNase_PH_C MSC
Motif
Other DBs
NCBI-ProteinID: AOH56788
UniProt: A0A1B3XUC1
Position
4267619..4269205
Genome map
AA seq 528 aa AA seqDB search
MNSVDVSNELHQLLTGHNVQTQLSVPKLVEKVLSRNEGVLTSTGAVKAETGKYTGRSPKD
KYIVEEASVKDKVDWGPVNQPISEDVFNKLYNKVIDYLKAKEEIFVFKGFAGAEESSRLP
IRVVNEYAWHNLFAHTLFIRPNEEELRGHEAEFTILSAPNFKADPAVDGTKSETFIIVSF
ERRTILIGGTEYAGEMKKSIFSIMNYLLPEAGILPMHCSANVGREGDVALFFGLSGTGKT
TLSADTNRKLIGDDEHGWASNGVFNIEGGCYAKTINLSREKEPQIFDAIRFGAVLENVVV
DPDTREADYDDSSLTENTRAAYQMQAIDNIVNPSIAGHPNTIIFLTADASGVLPPISKLS
KEQAMFHFLSGYTSKLAGTERGVTSPEATFSTCFGSPFLPLPATRYAEMLGDKIDEHNAK
VYLVNTGWTGGAYGTGSRMKLAYTRAMVQAALEGELANIETVKDEIFGLNIPLHVPGVPD
EVLQPIKTWADPEAYKQSATDLAAQFRANFKKFGSVPNEIEDLGGPIA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgtagacgtttctaatgagttacaccaattattaacaggacacaacgtgcaa
actcagctttcggttcccaaattggtcgaaaaggtattaagcaggaatgaaggcgtttta
acatcaactggcgcagtcaaggccgaaacaggcaaatacacgggtcgttcacctaaagat
aaatatatcgtcgaggaagcatccgttaaagataaagtcgattggggcccagtgaaccag
ccaatttccgaagatgtgttcaataagctatataataaagtaattgactacttaaaagca
aaagaagagattttcgttttcaaaggtttcgctggtgcagaagaatcatcacgccttcct
atccgtgtcgttaatgaatatgcttggcataatcttttcgcccatactttattcatccgt
ccgaacgaagaggagctgagaggccacgaagcagaattcacgatcctttcagcacccaac
ttcaaagctgatcctgcagtggacggaacgaaatccgaaacgttcatcatcgtttcgttt
gaacgccgtaccatcctgatcggcggaacggaatatgcaggtgaaatgaaaaaatcgatc
ttctcgatcatgaactacttacttccagaggctggaatccttcctatgcattgctctgct
aacgtaggacgtgaaggggacgtcgctttattcttcggactgtccggtacaggcaaaacc
actttatctgctgacacgaatcgcaaactgatcggtgatgatgagcatggctgggcttct
aacggtgttttcaacattgagggcggctgttatgcgaaaacgatcaacctatcacgcgaa
aaagaaccacaaatcttcgatgccatccgttttggagccgtcctggaaaatgtagttgtc
gatccggatactcgcgaagcggattatgatgatagttcattgactgaaaatacccgtgct
gcataccaaatgcaagcgatcgataacatcgtgaacccaagtattgccgggcacccaaat
acgatcattttcctgactgctgatgcttcaggcgtactgcctccaatcagcaagctgtcc
aaggaacaagccatgttccatttcctaagtggatacacgagcaagttagctggaacggaa
agaggcgtaacttcaccagaagcgacattctccacttgcttcggttcaccattcttaccg
ttacctgctacacgctatgctgaaatgcttggtgataaaattgacgagcacaacgcaaaa
gtataccttgtcaacacgggatggacaggcggagcgtacggaactggaagccgcatgaaa
cttgcttacacccgtgccatggtccaggctgcactcgaaggggaattggcaaacatcgaa
acggtcaaggatgaaatcttcggcttgaacattccgctacatgttccaggtgtaccggat
gaagtgcttcagccaatcaagacttgggcagatcctgaagcttataaacaatccgcaaca
gaccttgccgctcaattccgggcaaacttcaagaaattcggaagcgttccaaacgaaatc
gaagatcttggcggaccgatcgcttaa

DBGET integrated database retrieval system