KEGG   Bacillus muralis: ABE28_021090Help
Entry
ABE28_021090      CDS       T05340                                 

Definition
(GenBank) glycosyl hydrolase family 3
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bmur  Bacillus muralis
Pathway
bmur00520  Amino sugar and nucleotide sugar metabolism
bmur01100  Metabolic pathways
bmur01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ABE28_021090
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ABE28_021090
Enzymes [BR:bmur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ABE28_021090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 UxuA
Motif
Other DBs
NCBI-ProteinID: AOH56847
UniProt: A0A1B3XUG3
Position
complement(4340493..4341581)
Genome map
AA seq 362 aa AA seqDB search
MLESMTLEEKVGQLMMVGFKGTKASRKINELIEKKHIGGVIYFDRNMKSPKQVARLSNSL
QQTAEQSTLSLPLMVAVDQEGGEIIRMKESVSPLPAQQDLGKHASAEDMYKVAKLNGTEL
SSMGININFAPVLDLSKTDKRSVGEDPEKVYRYGKKTIQGLNDASVTGALKHFPGNGRSE
VDPHVDTSSVKANQLDLENSDIYPFKRIVSEMDDQSFFVMVTHIKYPAYDQQKPASLSKV
IIEDLLRGKLNYGGLVITDDLEMGAVNKYFSYEEMGKEAILAGADILLVCHEYAHELEVY
EGLLEAVKAGKVPMERIDQSVKRVLTYKLQAMNRTKADPDQAEKMVKNPESLKYLESLKL
AN
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaaagcatgacgcttgaagaaaaagtcggtcagctgatgatggttggcttcaag
ggaacaaaagcgagccgtaaaattaacgagctcatcgaaaaaaaacatataggcggcgtc
atttattttgaccgcaatatgaaatcgccaaaacaagtagcgaggttatccaattcgctt
cagcaaacggctgagcaaagtacactttcgcttccgctcatggtggccgtagatcaggaa
ggcggggaaatcatccggatgaaggaaagcgtatcgccgcttcctgcacagcaggatctg
gggaagcatgcatctgctgaagacatgtataaggtggcaaaactgaatggaacagaactg
agttcgatgggaatcaatataaattttgctcctgttcttgatttatcgaagaccgacaag
cgttcagtgggggaagatcccgaaaaggtttatcggtacggaaagaaaacgattcaaggc
ttgaatgatgcttccgtaacgggcgcgttgaaacactttccaggtaacggacggagcgaa
gtcgatccgcatgtcgatacatcctccgtgaaagcaaaccagctcgatctcgagaattcg
gatatttacccgttcaagagaatcgtaagcgaaatggatgatcaaagctttttcgtgatg
gtgacccacatcaaatatccggcttatgatcaacaaaaaccagcaagcctttccaaggtc
atcatagaagacctgctgcgaggcaagcttaactatgggggacttgtgattaccgacgat
ttggaaatgggggccgtgaacaagtacttttcctatgaagaaatggggaaggaagcgatt
cttgctggagctgatatattgctggtttgccatgaatatgcccatgagcttgaggtatac
gaaggcttactggaagctgttaaagcagggaaggttcctatggagcggattgatcagtcg
gtgaaacgagtcctgacatataagcttcaggcaatgaatcgaacgaaggctgatccggat
caagccgaaaaaatggtgaaaaatcctgagagcttaaaatatttggaaagcctgaaattg
gcaaattaa

DBGET integrated database retrieval system