KEGG   Bacillus muralis: ABE28_021650Help
Entry
ABE28_021650      CDS       T05340                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bmur  Bacillus muralis
Pathway
bmur00627  Aminobenzoate degradation
bmur01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmur00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ABE28_021650
Enzymes [BR:bmur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     ABE28_021650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Acid_phosphat_B Hydrolase_3 DUF2608
Motif
Other DBs
NCBI-ProteinID: AOH56959
UniProt: A0A1B3XUS1
Position
complement(4447974..4448741)
Genome map
AA seq 255 aa AA seqDB search
MKAYKGYLIDLDGTMYRGTEQIAEAAGFINDLKKRDIPYLFVTNNSSRTPAQVADKLRSI
GIASEDEQVFTTSMATANYIAQQKKDASVYVVGEEGIIEAIKEKGMQLVDENPDFLVMGI
DRGVNYEKLSKACLAVRNGATFISTNGDIAIPTEQGLMPGNGALTSVVSVSTQVQPIFIG
KPESVIVEQALQVLGVPKGETIMVGDNYDTDIMAGINAGIDTLLVHTGVTDSERLKQYDQ
QPTYVVNTLDLWKFE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgtataaaggatatttaattgacttagatggcaccatgtaccgcggtactgaa
caaatcgcggaggcggctgggttcataaatgacctgaaaaaaagggatatcccttattta
ttcgtaaccaacaactcgtcccggaccccggcacaggtagcggataaattgaggagcatc
gggatcgcttccgaagatgaacaagttttcacgacaagcatggcgactgccaattacata
gcccaacaaaaaaaggatgcgtccgtctatgtagtgggtgaagaagggatcatcgaggcc
atcaaggaaaaaggaatgcagctggtggatgaaaatccagacttccttgtgatgggcatc
gaccgtggcgtcaactacgaaaagctgtcaaaggcatgcctggcagtccggaatggagcg
accttcatctcaaccaacggggatattgccatccctaccgaacagggacttatgccgggt
aatggtgcgttgacctccgttgtatccgtttcgactcaagtgcagccgattttcatcggt
aagcctgaatcggtcatcgtcgagcaagcgctccaagtattgggggttcctaagggagag
acgatcatggtcggcgataactatgatacggatatcatggctggcatcaatgcaggcatc
gataccttgcttgtccataccggcgtaacggattcagaacgcctgaagcaatatgatcag
cagccaacatatgtggtcaacacgctcgatctatggaaattcgaatga

DBGET integrated database retrieval system