KEGG   Burkholderia mallei SAVP1: BMASAVP1_0210Help
Entry
BMASAVP1_0210     CDS       T00457                                 

Gene name
hisQ-1
Definition
(GenBank) histidine ABC transporter, permease protein
  KO
K10016  histidine transport system permease protein
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BMASAVP1_0210 (hisQ-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmv02000]
    BMASAVP1_0210 (hisQ-1)
Transporters [BR:bmv02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BMASAVP1_0210 (hisQ-1)
   Histidine transporter
    BMASAVP1_0210 (hisQ-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABM48679
Position
II:complement(234048..234737)
Genome map
AA seq 229 aa AA seqDB search
MLFQGFGPLLWAGTIETVKLAVLSLAASLVLGLAGAAAKLSSNRALASVGTFYTTLIRAV
PDLVLMLLLFYGIQILLNDVTDMLGAEQIDIDPFVAGIVTLGFIYGAYFTETFRGAFLAV
PRGQLEAGFAYGMGAWRVFARIMFAQMMRFALPGIGNNWQVLVKATALVSIIGLADVVKA
AQDAGKSTLNFFFFTLAAGAIYLAITTLSNLVLMYLEKRYSAGVRRVAL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctctttcaaggcttcggcccgctgctctgggccggcacgatcgagacggtcaagctc
gccgtgctttcgctcgccgcgtcgctcgtgctcgggcttgccggcgcggccgccaagctg
tcgtccaatcgcgcgttggcgagcgtcggcacgttctacacgacgctgattcgtgcggtg
ccggacctcgtgctgatgctgctgctgttctacggcatccagatcctgctgaacgacgtg
accgacatgctcggcgccgagcagatcgacatcgatccgttcgtcgccggcatcgtcacg
ctgggcttcatctacggcgcctacttcaccgagacgtttcgcggcgcgttcctcgcggtg
ccgcgcggccagctcgaagcgggcttcgcgtacggcatgggtgcgtggcgcgtgttcgcg
cggatcatgtttgcgcagatgatgcgcttcgcgctgcccggcatcggcaacaactggcag
gtgctcgtgaaggcgaccgcgctcgtgtcgatcatcgggctggccgacgtcgtgaaggcc
gcgcaggacgccggcaagagcacgctgaatttcttcttcttcacgctcgcggcgggcgcg
atctacctcgcgatcacgacgttgtcgaacctcgtgttgatgtacctcgaaaaacgctat
tcggcgggtgtgcggagggtggcgctgtga

DBGET integrated database retrieval system