KEGG   Burkholderia mallei SAVP1: BMASAVP1_0605
Entry
BMASAVP1_0605     CDS       T00457                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
bmv  Burkholderia mallei SAVP1
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmv02044]
    BMASAVP1_0605
Secretion system [BR:bmv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMASAVP1_0605
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ABM48785
Position
II:612578..614104
AA seq 508 aa
MNRDTEQTTMEGEHLQSPKHDDAPDATPPESPASLLDELIEAARVKRDEDAYPITRHGIQ
AFVAHLAKPKRPIETVSQATIDDMIAEIDRKLCRQIDAILHDPAFQQLESTWRSLKFLVD
RTDFRENVKVQILDVGKTALFDDFEDSPDITKSGLYQKVYTAEYGQFGGQPIGAIVANYT
FGPGAQDVKLLQYVASTSAMAHTPFIAAAGPAFFGIDSFGKLPNVKDLASLFEGPQYAKW
NAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYEERVDGGDAHFLWGNAAFAFATR
LTASFADYRWCANVIGPKGGGTVTDLPLYAYESMGEIQNKIPTDVLISERREFELAEQGF
IALTMRKNSDNAAFFSANSTQKPKFFGISKEGKEAELNYRLSTQLPYIFVVNRLAHYIKV
IQRENIGSWKERGDLEQELNQWIRQYVVDMDNPSQSVRSRRPLRQAQIVVSDVEGEPGWY
RVDMKVRPHFKYMGAFFTLSLVGKLEKR
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgaaccgcgacacggaacagacgaccatggaaggcgaacacctgcaatccccgaagcac
gacgacgcgccggacgcgacgccgcccgagtcccccgcctcgctgctcgacgagctgatc
gaggccgcgcgcgtgaagcgcgacgaagacgcatacccgatcacgcgccacggcatccag
gcgttcgtcgcgcatctggcgaagcccaagcgcccgatcgagaccgtgagccaggcgacg
atcgacgacatgatcgccgagatcgaccgcaagctgtgccggcagatcgacgcgatcctc
catgacccggcattccagcaactcgaatcgacgtggcgctcgctgaagtttctcgtcgat
cgaacggatttccgcgagaacgtgaaggttcagattctcgacgtcggcaaaacggcgctg
ttcgacgacttcgaggattcgcccgacatcacgaaatccgggctgtaccagaaggtctat
acggccgagtacggccaattcggcggccagccgatcggcgcgatcgtcgcgaactacacg
ttcgggcccggcgcgcaggacgtcaagctgctgcagtacgtcgcgagcacgtcggcgatg
gcgcatacgccgttcatcgcggcggcgggccccgcgttcttcggcatcgattcgttcggc
aagctgccgaacgtgaaggatctcgcctcgctgttcgaggggccgcaatacgcgaaatgg
aatgcgtttcgcgaaagcgaggacgcgcgctacgtcggcctcacgctgccgcgcttcttg
ctgcggctgccttacggcgcgaacacgacgcccgtcaagcgcttcaactacgaggagcgc
gtcgacggcggcgacgcgcattttctgtggggcaacgcggcgttcgcgttcgcgacgcgc
ctcaccgcgagcttcgccgactatcgctggtgcgcgaacgtgatcgggccgaaaggcggc
ggaacggtgaccgatctgccgctctacgcgtacgaatcgatgggcgagatccagaacaag
atcccgaccgacgtgctgatttccgagcgccgcgagttcgagctcgccgaacagggcttc
atcgcgctgacgatgcgcaagaacagcgacaacgccgcctttttctccgcgaactccacg
cagaagccgaagttcttcggcatcagcaaggaaggcaaggaggccgagctcaactatcgg
ctcagcacgcaactgccgtacatcttcgtcgtcaaccggctcgcccattacatcaaggtg
atccagcgggaaaacatcggctcgtggaaggagcgcggcgatctcgagcaggagctcaac
cagtggatccgccagtacgtcgtcgacatggacaacccgtcgcagagcgtgcgcagccgc
cgcccgctgcggcaggcgcagatcgtcgtgtcggacgtcgagggcgaacccggctggtat
cgcgtggacatgaaggtgcggccgcacttcaagtacatgggcgcgttcttcacgctgtcg
ctcgtcggcaagctcgaaaagcgctag

DBGET integrated database retrieval system