KEGG   Burkholderia mallei SAVP1: BMASAVP1_0606
Entry
BMASAVP1_0606     CDS       T00457                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMASAVP1_0606
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmv02044]
    BMASAVP1_0606
Secretion system [BR:bmv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMASAVP1_0606
SSDB
Motif
Pfam: T6SS_HCP THP2
Other DBs
NCBI-ProteinID: ABM47969
Position
II:614324..614833
AA seq 169 aa
MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARLQEGLTPAAAARGTIT
LTKEMDRSSPQFLQALGKREMMEEFEITIHRPKTDTTGGDLTELLFTYKFEKVLITHMDQ
YSPTPHKDDSNGIKEGLLGYIEEIKFAYSGYSLEHAESGIAGAANWTNG
NT seq 510 nt   +upstreamnt  +downstreamnt
atgctggccggaatatatctcaaggtcaaaggaaaaacccagggggaaatcaaaggctcc
gtcgttcaggaaggtcatgacgggaagatccacatcctcgccttcaagaacgactacgac
atgcccgccaggctccaggaaggcctgacgcccgccgccgccgctcgcggcacgatcacg
ttgacgaaggaaatggacagatcgtcgccgcaattcctgcaggcgctcggcaagcgcgag
atgatggaagagttcgagatcacgatccaccgtccgaagacggatacaacaggtggggac
ctgaccgaactcctgttcacgtacaagttcgaaaaagtgctgatcacccacatggaccaa
tactcgcccacgccgcacaaagacgatagcaacggcatcaaggaaggcttgctcggctat
atcgaggagatcaagttcgcgtattcgggatactcgttggaacacgcggaatcgggcatc
gcgggcgccgcaaactggacgaatggctga

DBGET integrated database retrieval system