KEGG   Burkholderia mallei SAVP1: BMASAVP1_0611
Entry
BMASAVP1_0611     CDS       T00457                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMASAVP1_0611
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmv02044]
    BMASAVP1_0611
Secretion system [BR:bmv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMASAVP1_0611
SSDB
Motif
Pfam: Phage_GPD Phage_base_V LmeA
Other DBs
NCBI-ProteinID: ABM48674
Position
II:621182..624205
AA seq 1007 aa
MPSSPRHDAPASRANAAPSANARRFTFASDAYDPATFDVVDINGRDAISQPYRFEITLVS
RQLRIDFAKMLSRGATLAILPPFGEAGTTRYAGVLAEFEQKKRFRDFTVYRATLVPRLWR
LSLYKASDVYLNEQTIPDIVKRVLRAASFGSRDFRMRHGGGYRKRSFVCQYDESHLDFVS
RWMEKEGLYYYFEHDGRHETLVIVDDRRHQPGPADDLALRYLPATSLDAGIEADRVQAFT
CRATPLPREVVLRDFNHRKAELSLEVRERVARDGVGERVSSDEHFHTKDEGQRYAKLRAE
ALVCEGRRFAGESTAAGLRAGRFFALSGHYREDFDGRYLVTALTHRGSQAHLLFPDLDAP
FGATPGEPIYRAEFEAIAADLQYRPPRTTPKPRAAGVVSAIVDGEGGGKLAELDEYGQYK
VRFPFAHTAHPANKASARIRMATPYAGDDRGMHLPLLKRTEVKIAFDGGDPDRPVIVGAV
PNSSHRSVVTRRNPAEHRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGDGLALLT
SGNKFDFSLGNAYSFSGGLKCSVSMGGNTDVYVGVRNSLDVSANFLTTLQGNLRWMLPGS
RSFEINDSASTLLQTLHKQSATGAIRLSAGQDASALLQKQLDKLKGTVRKFMIVSGLANA
GSAAAAAGLIKGGGKLADLPWAGFGISAAQFAGVTGVSTALMATSRTLLANVAKLQEALP
LVADLSLGKQGIALAAKNLTHATRMSLTVDGVSWSTHAKGPGAAGAAMSVGKGRWGVEAA
KHAHVHASDTLLFAVPADPTTQFDLKDLIGLRRDLDECMKDIADLEADISENEVLSTDQN
TFGVSALIPTPPSPAGALAAVAIKVKQAKLVELKAKQKLVALKVDNLQQKFAKHVQHLSA
VRMSASDAQLGFKGNRLVATADGVTLAHAQGKAKLDVREAKIGVTAGKSSVELDEGKIAA
GCGSASLKLGSDGAIDVSATDVKLNGTNVKLNGSASLKFDGQLIQLG
NT seq 3024 nt   +upstreamnt  +downstreamnt
atgccttcgtccccccgccacgatgcgcccgcgtcgcgcgcgaacgccgcgccgtccgcg
aacgcgcgacgcttcacgttcgcgagcgacgcgtacgaccccgcgacattcgacgtcgtc
gacatcaacggccgcgacgcgatctcgcagccgtaccggttcgagatcacgctcgtgagc
aggcagttgcggatcgacttcgcgaagatgctgagccgcggggcgacgctcgcgatcctg
ccgccgttcggcgaggccggcaccacccgctatgccggcgtgctcgccgaattcgagcag
aagaaacgctttcgcgacttcaccgtctatcgcgcgacgctcgtgccgcgcctctggcga
ctatcgctgtacaaggcgtcggacgtctatctgaacgagcagacgattcccgacatcgtc
aagcgcgtgctgcgcgccgcctcgttcggcagccgcgatttccgcatgcggcacggcggc
ggctaccgcaagcgcagcttcgtctgccaatacgacgagagccatctcgatttcgtgtcg
cgctggatggagaaggaaggcctctactactacttcgagcatgacggccggcacgaaacg
ctcgtgatcgtcgacgaccgccgccatcagcccggccccgccgacgatctcgcgctgcgc
tacctacccgcgaccagcctcgacgcgggcatcgaagcggaccgcgtgcaggcgttcaca
tgccgggcgacgccgctgccgcgcgaagtcgtgctgcgcgacttcaaccaccgcaaggcg
gagctctcgctcgaagtccgcgagcgcgtggcgcgcgacggcgtcggcgagcgggtgtcg
agcgacgagcacttccacacgaaggacgaagggcagcgctacgcgaagctgcgcgccgag
gcgctcgtctgcgaagggcgccgattcgccggcgaatcgaccgcggccgggctgcgcgcc
ggccgcttcttcgcgctgtcgggccactaccgcgaggatttcgacggccgctatctggtg
acggcgctcacgcatcgcggctcgcaggcacacctgctgtttcccgatctcgacgcgccg
ttcggcgcgacgccgggcgagcccatctaccgcgccgagttcgaggcgattgccgccgac
ctccagtaccggccgccgcgcacgacgcccaagccgcgcgcggcgggcgtcgtcagcgcg
atcgtcgacggcgagggcggcggcaagctcgccgagctcgacgaatacggccagtacaag
gtgcgctttccgttcgcgcacaccgcgcatccggcgaacaaggcctccgcgcgcatccgg
atggcgacgccctacgcgggcgacgaccgcggcatgcacctgccgctgctgaagcgcacc
gaagtgaagatcgcattcgacggcggcgatccggaccgccccgtgatcgtcggcgcggtg
cccaactcgtcgcaccgcagcgtcgtcacgcgccgcaaccccgccgagcatcgcatcctc
accgagcacaaccagctctacatgaaggacggcagcggcgcggcgacgtggctgcacgcg
ccgaacaaccacatcggcatcggcgcggtcgggccgggcgacggcctcgcgctcctcacg
tccggcaacaagttcgacttctcgctcggcaacgcgtacagcttctcgggcgggctcaag
tgctcggtgtcgatgggcggcaacaccgacgtctacgtcggcgtgcgcaacagcctcgac
gtcagcgcgaacttcctgacgacgctgcagggcaacctgcgctggatgctgcccggcagc
cggagcttcgagatcaacgacagcgcatcgacactgctgcagacgctgcacaagcagtcc
gcgacgggcgcgatccggctgtccgccgggcaggacgcgtccgcgctgctgcaaaagcag
ctcgacaagctcaagggcacggtgcgcaagttcatgatcgtgtcgggcctcgcgaacgcc
gggtccgcggccgccgccgcggggctcatcaagggcggcggcaagctcgccgatctgccg
tgggcgggcttcggcatatccgccgcgcagttcgccggcgtgaccggcgtcagcacggcg
ctgatggcgacctcgcgcacgctgctcgcgaacgtcgcgaagctccaggaggcgttgccg
ctcgtcgccgatctgtcgctcggcaagcagggcatcgcgctcgccgcgaagaacctcacg
cacgcgacgcggatgtcgctcaccgtcgacggcgtctcgtggtcgacgcacgcgaagggg
cccggcgcggcgggcgccgcgatgagcgtcggcaagggccgctggggcgtcgaagcggcg
aagcacgcgcacgtccacgcgagcgacacgctgctgttcgcggtgccggccgacccgacg
acccagttcgacctgaaggacctgatcgggctgcgccgcgatctcgacgaatgcatgaag
gacatcgccgatctcgaagccgacatttcggaaaacgaagtgctgtcgaccgatcagaac
acgttcggcgtcagcgcgctcatccccacgccgccgtcgcccgccggcgcgctcgcggcg
gtcgcgatcaaggtgaagcaagcgaagctcgtcgagctgaaggccaagcagaagctcgtc
gcgctgaaggtcgacaacctgcagcagaagttcgcgaagcacgtgcagcacctgagcgcc
gtgcggatgagcgcttccgacgcgcagctcggcttcaagggcaaccggctcgtcgcgacg
gccgacggcgtcacgctcgcgcatgcgcagggcaaggcgaagctcgacgtgcgcgaagcg
aagatcggcgtcacggcgggcaaatcgagcgtcgagctcgacgaaggcaagatcgcggcc
ggctgcggcagcgcatcgctgaagctcggcagcgacggcgcgatcgacgtgagcgcgacc
gacgtcaagctgaacggcaccaacgtcaagctgaacggcagcgcgtcgctgaagttcgac
ggccaactgatccagctcggctga

DBGET integrated database retrieval system