KEGG   Burkholderia mallei SAVP1: BMASAVP1_0616
Entry
BMASAVP1_0616     CDS       T00457                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bmv  Burkholderia mallei SAVP1
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ABM49343
Position
II:629144..629941
AA seq 265 aa
MNARHIAPPAATRARRPMQPGRPSWPSRTYRACAARTCAAVLVALAALAGCAARVTEEQA
RADVRWDYAPDALRIDIDASARLNEYLNAPHTLLLAVFQSADAKAFRQLADDPDRLRMTL
AAGGPAADFIQTTRYVVAPGQHVALSIDRAQQARYVGIVAGYYDADGPRAARLFEVPLRI
DKRGWFSSTYRAAPRTLELKLRLGAQSITDAREAPLNLPPPGARAWTALDSGAKTLALPS
ADANDGGSGKRDKRGNAAARAPRKQ
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaacgcacgacacattgccccgccggccgcgacgcgcgcgcgccggccgatgcagccc
ggccggccgtcatggccgtcgcgaacgtatcgcgcatgcgcggctcgcacatgcgctgcc
gtgctcgtcgcgctcgccgccctcgccggctgtgcggcccgcgtcaccgaagagcaggcg
cgcgccgacgtgcgatgggactacgcgcccgacgcgctgcgcatcgatatcgacgcgtcg
gcgcggttgaacgaatacctgaacgcgccgcacacgctgttgctcgcggtgttccagagc
gcggacgcgaaggcgttccgccagctcgccgacgatccggaccggctgcgcatgacgctc
gcggcgggcggccccgccgcggacttcattcagacgacccgctacgtcgtcgcgcccggc
cagcatgtcgcgctgtcgatcgatcgcgcgcagcaggcgcgctacgtcggcatcgtcgcc
ggctactacgacgccgacggcccacgcgcggcgcgcctgttcgaggtgccgctgcgcatc
gacaagcgcggctggttctcctccacctatcgcgccgcgccgcgaacgctcgagctgaag
ctcaggctcggcgcgcagagcatcaccgacgcgcgcgaagcgccgctgaacctgccgccg
ccgggcgcgcgcgcatggacggcgctcgacagcggcgcgaagaccctggcgctgccgagc
gccgacgcgaacgacggcggcagcggcaagcgcgacaaacgcggcaacgccgccgcccgt
gcgccgcgcaagcaatga

DBGET integrated database retrieval system