KEGG   Burkholderia mallei SAVP1: BMASAVP1_0618
Entry
BMASAVP1_0618     CDS       T00457                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMASAVP1_0618
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmv02044]
    BMASAVP1_0618
Secretion system [BR:bmv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMASAVP1_0618
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: ABM47994
Position
II:631368..632033
AA seq 221 aa
MKLTDSMMPLVAYARQLAQSPRGDAAEVALRLDILIERARDHAACAGAPAADVDDALFAV
CAWIDEALLNSGWDDADRWTLRLLQKRYFDTSHAGVVFFERLGTLDGARASVLEVYLLCL
RLGFRGRYGYDGGDGPLDAIRQRALDALSAHAPPCAAGEPPFPAAYAHAGPHAAAAKART
RRRIARAGLSVGLPLAILLSLYLIYHVVIVRMVDAVYPRLQ
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaagctgaccgattcgatgatgccgctcgtcgcgtatgcgcggcagctcgcgcaatcg
ccgcgcggcgacgccgccgaagtcgcgctgcggctcgacatcctgatcgagcgcgcgcgc
gaccacgcggcgtgcgcgggcgcacccgcggccgacgtcgacgacgcgctgttcgcggtg
tgcgcgtggatcgacgaggcgctgctgaacagcggctgggacgatgccgatcgctggacg
ctgcggctgctgcaaaagcgctacttcgatacgtcgcacgcgggcgtcgtgttcttcgaa
cgcctcggcacgctcgacggcgcgcgcgcgagcgtgctcgaggtctacctgctgtgcctg
cggctcggctttcgcggccgctacggctacgacggcggcgacggcccgctcgacgcgatc
cgccagcgcgcgctcgatgcactgtcggcgcacgcgccgccgtgcgccgcgggcgagccg
ccgtttcccgccgcctatgcgcacgccggcccgcacgccgccgccgcgaaagcgcgcacg
cgccgccggatcgcgcgcgcggggctgagcgtcgggctgccgctcgccatcctgctgtcg
ctctatctgatctatcacgtcgtcatcgtgcggatggtcgacgcggtgtaccccaggctg
caatga

DBGET integrated database retrieval system