KEGG   Burkholderia mallei SAVP1: BMASAVP1_0623
Entry
BMASAVP1_0623     CDS       T00457                                 

Definition
(GenBank) hypothetical protein
Organism
bmv  Burkholderia mallei SAVP1
SSDB
Motif
Pfam: Big_5 UCH
Other DBs
NCBI-ProteinID: ABM48259
Position
II:636629..638053
AA seq 474 aa
MNARRPAFGLIASHASRRRAVESVRAHFPFMFTLCLAMKHTSNHSDPSGAPSSARRAASD
SSRLVRGMRSPQRGGAALALAVASLAGCGGGDSGEPAPREFAPPTVQLAYPTQPNSPVAP
APTAHVSSGHTPPATAPAAMPTASPTATPTASPTATAAASPSAPSTATPNAPPAAPPAVV
ATRVPPTHAALRRPTIELEFDRAIEPGSVPHIVLRADDGTSVAVGPLSWLSDRRIAFAPR
KPLKSNSRYEIMVPAGIRSTTGERSAHPLTSSFDTAPVTPPRGLPNLDGASCFINTALQL
AVHSSALDDILSNEAVPPAVRTLLEDYDAASADALDAQLAAAVAALRATPEVPDSGPGQT
LEVMQALRMPLYDTSSANNATNNADAIRHAPPNTKAFFLNSYPPLSYADLPNHDRLVAFD
YSTGGHYVAYVKRDGIWYRIDDAQVSAVNEQDLLALPAFNPANGSVSIEIAIYR
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaacgctcgacgtccggcgttcggcctgattgcgtcgcacgcgtcacgccgccgggcc
gtcgaatccgtgcgcgcccactttccgttcatgttcaccctctgtcttgcgatgaaacac
acttcgaaccactccgacccttccggtgcgccgtcgtcagcgcgacgcgccgcatccgat
tcgtcccgcctcgtccgcggcatgcgctcgccccaacgcggcggcgcggcactggcgctg
gccgtcgcctcgctcgccggatgcgggggcggcgattcgggcgaacccgctccacgcgaa
ttcgcgcccccgacagtgcaactcgcctacccgacgcaaccgaactcgcccgtcgcacca
gcgcccaccgcgcacgtatcgagcggacacacgcctccggccacggcgcccgccgcgatg
cccaccgcttcacccaccgcgacgcctaccgcttcacccaccgcgacggctgccgcttcg
ccctccgcgccatccactgcgacgcccaacgccccgcccgccgctccgccggccgtcgtc
gccacccgcgtcccgccgacgcacgcggcgttgcgccgcccgacgatcgaactcgaattc
gatcgcgcgatcgagccgggttcagtcccacacatcgtgctgcgcgccgacgatggcacg
agcgtcgccgtcggcccgttgtcgtggctgagcgatcgccggatcgcgttcgcgccgcgc
aaaccgctcaagtcgaacagccgctacgaaatcatggtgcccgccggcatcaggagcacc
acgggcgaacggtcggcccatccgctaacgagcagcttcgataccgcgcccgttacgccg
ccgcgcggcctgcccaatctcgacggcgcctcgtgcttcatcaacacggcgctgcaattg
gcggttcactcgtcggcgctcgacgacattctgtcgaacgaagccgtcccgcccgccgtc
cgcacgctgctcgaagactacgacgccgcatcggctgatgcactcgacgcgcagttggcc
gccgcggtcgccgcgctgcgcgccacgccggaggtcccggacagcgggccgggacaaacg
ctggaagtgatgcaagcgttgcggatgccgttatatgacacgagcagcgcgaacaacgca
acgaacaacgccgacgccatacgtcatgcgccgcccaacaccaaggcgttctttctgaac
tcctatccaccgctttcctacgcggatctgccgaaccacgaccggctcgtcgcgttcgac
tacagcacgggcggtcactatgtcgcttatgtgaagcgggatggaatctggtatcgaatc
gacgatgcccaggtcagcgccgtcaacgaacaggacttgcttgccctgccggcgttcaac
cccgctaacggcagcgtgtcgatcgaaatcgcgatctatcgatga

DBGET integrated database retrieval system