KEGG   Burkholderia mallei SAVP1: BMASAVP1_0732Help
Entry
BMASAVP1_0732     CDS       T00457                                 

Definition
(GenBank) OmpA domain protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMASAVP1_0732
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmv02044]
    BMASAVP1_0732
Secretion system [BR:bmv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMASAVP1_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU OmpA
Motif
Other DBs
NCBI-ProteinID: ABM49315
Position
II:complement(741746..743404)
Genome map
AA seq 552 aa AA seqDB search
MLDRAAANPDLVTRVPTLSSLSSAAMTSSAVSTTGTTNTVASGGAAAGAPSFAPPAADAF
PQADGAPRNPAVLQFPVPGGAPAPADARVAAPVVYSAQGEQAAIMKAGLQQASWNNPFVS
HALPAVLQLQRHLAAGPLNQAAIRTQLGLEVRLYRERLAASGCEWEQIRDASYLLCTYLD
ETVNDAAREHAQVVYDGERSLLVEFHDDAWGGEDAFADLSRWMKTEPPPIPLLSFYELIL
SLGWQGRYRVLDRVDVLLQDLRSQLHALIWHHVPPEPLGTELVAPAKRRRSWWTAGRAAA
VALGVLVLAYGAISFWLDSQGRPIRNALAAWMPPTRTINIAETLPPPLPQILTEGWLTAY
KHPQGWLLVFKSDGAFDVGKANVRADFMHNIERLGLAFAPWPGDLEVIGHTDSRPIRTSE
FPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPIDTAKTAAAYE
RNRRVDVLWKVIPDGAQQSGRSLNLQQPEKPGQVPMRPAMPEGVEIAPDGQLPYATSTTM
PATRPTTEGRQP
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatcgcgcggcggcgaatccggatctcgtgacgcgcgtgccgacgctgtcgtcg
ctgtcgagcgcggcgatgacgagctccgccgtatcgaccaccggcacgacgaacacggtg
gcgtcgggcggcgcggccgcgggcgcgccgagcttcgcgccgccggccgccgacgcgttt
ccccaagccgacggcgcgccccgcaaccccgcggtgctgcaattcccggtgccgggcggc
gcgcccgcgcccgccgacgcgcgggtggccgcgcccgtcgtctatagcgcgcagggcgag
caggccgcgatcatgaaagcaggcctgcagcaggcgagctggaacaacccgttcgtgtcg
cacgcgctgcccgcggtgctgcaactgcagcgccacctcgcggccggcccgctcaatcag
gccgcgatccgcacgcagctcggcctcgaggtgcggctctaccgcgagcggctcgccgcc
tccggctgcgaatgggagcagatccgcgacgcatcgtacctgctctgcacgtatctcgac
gaaaccgtcaacgacgcggcgcgcgagcacgcgcaagtcgtctacgacggcgagcgcagc
ctgctcgtcgaattccacgacgacgcgtggggcggcgaggacgcgttcgccgacctgtcg
cgctggatgaagaccgagccgccgccgattccgcttctgtcgttctacgaactgatcctg
tcgctcggctggcagggccgctaccgcgtgctcgaccgcgtcgacgtgctgctgcaggat
ctgcgctcgcaactgcacgcgctgatctggcatcacgtgccgcccgagccgctcggcacc
gagctcgtcgcgcccgcgaagcggcgccgctcgtggtggacggccgggcgcgcggcggcc
gtcgcgctcggcgtgctggtgctcgcgtacggcgcgatcagcttctggctcgattcgcag
ggccgcccgatccgcaacgcgctcgccgcgtggatgccgcccacgcgcacgatcaacatc
gccgagacgctgccgccgccgctgccgcagattctcaccgaagggtggctcaccgcgtac
aagcatccgcaaggatggctgctcgtgttcaagagcgacggcgcgttcgacgttggcaag
gcgaacgtgcgggcggacttcatgcacaacatcgagcggctcggcctcgcgttcgcgccg
tggccgggcgacctcgaggtgatcggccacaccgattcgcggccgatccgcacgagcgag
ttcccggacaaccaggcgctgtccgaagcgcgggcgcgcaacgtcgccgacgaactgcgc
aagaccgcgctgccgggcggcgcgcgcgcgccggagaacgcggtgcagcgcaacatcgag
tactcggggcgcggcgacgcgcagccgatcgacaccgcgaagacggccgccgcgtacgag
cgcaaccgccgcgtcgacgtgctgtggaaggtgattcccgacggcgcgcagcaatcgggc
cgcagcctgaacctgcagcagccggagaagcccgggcaggtgccgatgcgtccggcgatg
ccggagggcgtggagatcgcgcctgacgggcaactgccgtatgcgacgtcaaccacgatg
ccagcaacgcgaccgaccacggagggccgtcagccatga

DBGET integrated database retrieval system