KEGG   Burkholderia mallei SAVP1: BMASAVP1_0735Help
Entry
BMASAVP1_0735     CDS       T00457                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMASAVP1_0735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmv02044]
    BMASAVP1_0735
Secretion system [BR:bmv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMASAVP1_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: ABM48938
Position
II:complement(744845..745438)
Genome map
AA seq 197 aa AA seqDB search
MRHKMGPFKSIAAALALGVLAGCSAFSSSKPEEPRQLHVTLVGGARLNVAPTGEPRPVQT
CVYVVTAADWLPTQGGDDSSCASRGQDSTVVADSRHVIAPNQLLQFSLNLPRSGELWLVA
DADYARRPANYGPLRVRVEGRGLIHMAVWLDRDGIYNALLPGPVPVGGAIAPAAVRPDEP
PPERKTKTTYGTRRSRQ
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcacaagatgggccccttcaaatcgatcgcggcggcgctcgcgctcggcgtgctc
gccggctgctcggccttctcgtcgtcgaagccggaagagccgcggcagttgcacgtgacg
ctcgtcggcggcgcccggctgaacgtcgcgccgacgggcgagccgcgtccggtgcagacg
tgcgtgtatgtcgtgaccgcggccgactggctgccgacgcagggcggcgacgattcgtcg
tgcgcgtcgcgcgggcaggacagcacggtcgtcgccgactcgcggcacgtgatcgcgccg
aaccagttgctgcagttctcgctgaacctgccgcgctcgggcgagctctggctcgtcgcc
gacgccgactacgcgcgccggccggcgaactacgggccgctgcgcgtgcgcgtcgagggc
cgcggcttgattcacatggctgtctggctggaccgcgacggcatctacaacgcgttgttg
ccggggcccgtgcccgtcggcggcgcgatcgccccggcggcggtccgccccgacgagccg
ccgcccgagcgcaagacgaaaaccacctatgggacaaggagaagcaggcaatga

DBGET integrated database retrieval system