KEGG   Burkholderia mallei SAVP1: BMASAVP1_0741Help
Entry
BMASAVP1_0741     CDS       T00457                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMASAVP1_0741
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmv02044]
    BMASAVP1_0741
Secretion system [BR:bmv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMASAVP1_0741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Phage_base_V
Motif
Other DBs
NCBI-ProteinID: ABM48712
Position
II:complement(752339..754585)
Genome map
AA seq 748 aa AA seqDB search
MRLIELRSPLLDPDAVALSFVVHESLSQEPSYQLDLLSHDPDLDFDALFGSTLSADIDLG
EGDIRTFNTHVFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQNMSVPQIVEQVFQ
GHQRNGYRFELEGTYEPREYCVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQ
RFEDLPLPNDTLEYLPDGEESRAIQGREGVQRLQRTRRIKSNNVALRDFDYHAPSNKLDS
DAQQVSPPNLEGIPLEYYDYAAGYREPEQGERLARLRLEAIQAESHTLVGEANARALATG
RAFTLIGHPALGRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADDQPFRPLLTTP
RPEVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVSQAWAGKGWG
VIAMPRVGQEVLVTYVDGDLDRPLVTGIVYNGENPTPYDLPKDIRYTGLVSRSIKRAGGY
QNASQITFDDQRGAERVMIHAERDMQQTVERNSSTSVVGISISFTGISVSYTGLSVSFTG
VSASFTGVSTSFTGVSTSFTGVSTSFTGVDTGFKGVSTSFTGVDTSFKGVSTSFTGVSTS
LTGSSNSVTGVSNSMTGISSSWTDVSMSTTGQSQSITGVSLSYTGTSNSMTGTSTSVTGT
STSITGTSMSNTGSSTSITGTSMSTTGSSTSVTGSSVSTTDSSVSTTGSSVSTTGSSVST
TGFSFSYTGVSYSDTGIDLKKVGMQVKS
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgatcgaactgcgcagtcccctgctggacccggatgcggtggcgctgagcttc
gtggtgcacgagagcttgtcgcaggagccgtcgtatcaactggatctgctgagccacgac
ccggatctggacttcgacgcgctgttcggctcgacgctgtcggccgacatcgacctgggc
gaaggcgacatccggacgttcaacacgcacgtgttcggcggctacgacacggggcagatg
agcgggcaatacacgtacacgctggagctgcgaagctggctgtcgtttctcgcggagaac
cgcaacagccggatcttccagaacatgagcgtgccgcagatcgtcgagcaggtgttccag
ggccatcagcgcaacggctaccggttcgagctcgaaggtacgtacgagccgcgcgagtac
tgcgtgcagtttcaggaaacggatctgaacttcgtgaagcggctgctggaggacgaaggg
atctacttctgggtggagcacgagccggatcgtcatgtggtggtgatctcggacacgcag
cggttcgaggatctgccgctgccgaacgacacgctggagtatctgccggacggcgaggag
tcgcgcgcgatccaggggcgcgaaggggtgcagcggctgcagcgcacgcggcggatcaag
tcgaacaacgtcgcgctgcgggatttcgactatcacgcgccgtcgaacaagctcgacagc
gacgcgcagcaggtgtcgccgccgaacctcgaggggattccgctcgagtattacgactat
gcggcgggctaccgcgagcccgagcagggcgagcgtctcgcgcggctgcggctcgaggcg
attcaggcggaatcacacacgctggtgggcgaggcgaacgcgcgcgcgctggccacgggc
cgggcgttcacgttgatcgggcatccggcgctggggcgcaatcgtcggtactacgtgacg
aacagcgagctgacgttcatccaggacggaccggacagcacgtcgcaggggcgcaacgtc
gcggtgaagttccgcgcgcttgccgacgatcagccgtttcggccgctgttgacgacgccg
cgtcccgaagtgccgggtatccagagcgcgacggtggtgggtccggagatgtcggaagtg
cataccgacaagctcgggcggattcgcgtgcatttccattgggaccgctacaagacgacc
gaggcggatgcgtcgtgctggatacgcgtgtcgcaggcatgggcgggcaagggctggggc
gtgatcgcgatgccgcgggtcgggcaggaagtgctcgtcacgtatgtcgacggcgatctc
gatcggccgctcgtgacgggcatcgtctacaacggcgagaacccgacgccttatgacttg
ccgaaggacatccgctacacggggctggtgtcgcgttcgatcaagcgtgcgggcggttat
cagaacgcgagtcagatcacgttcgatgaccagcgcggcgcggagcgcgtgatgatccac
gcggagcgcgacatgcagcagacggtcgagcgcaacagctcgacgtcggtcgtcggcatc
tcgattagcttcacgggcatctcggtgtcgtacacggggttgtcggtgagcttcaccggc
gtgtcggcgagcttcacgggcgtgagcacgtcgtttaccggcgtgagcacgagtttcacc
ggcgtgtcgacgtcgtttaccggcgtcgacaccggcttcaagggcgtgtcgacgtcgttt
accggtgtcgataccagcttcaagggtgtgtcgacttcgttcacgggcgtaagcacgagc
ctcaccggttcgagcaactcggtgacgggcgtatcgaacagcatgacgggcatctcgtca
tcatggaccgacgtcagcatgtcgacgaccggccaatcccaaagcatcacgggggtatcg
ctgtcgtacacgggcacgtcgaacagcatgacgggcacgagcacgtcggtgacgggcacc
tcgacgagcatcaccggcacgtcgatgtcgaacaccggcagctcgacgagcatcacgggc
acgtcgatgtcgacgacgggcagctcgacgagcgtcaccggctcgagcgtatcgacgacc
gacagctcggtgagcacgacgggctcgagcgtgtcgacaacgggcagcagcgtgtcgacg
acgggtttcagcttctcgtacaccggcgtcagctattcggacaccggtatcgacctgaag
aaggtcggcatgcaagtgaagagctga

DBGET integrated database retrieval system