KEGG   Burkholderia mallei SAVP1: BMASAVP1_0746
Entry
BMASAVP1_0746     CDS       T00457                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
bmv  Burkholderia mallei SAVP1
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmv02044]
    BMASAVP1_0746
Secretion system [BR:bmv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMASAVP1_0746
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ABM48055
Position
II:complement(760311..760742)
AA seq 143 aa
MSDLQLYNKLSKRIRRHSLQEVVADHLVDLMNHAIRGARMRIADDSPAAHSVLNFGCPPM
QMAGATKINPVHAAAHICEVIRRFEPRVDPASTVVKPRTESRKRLAQTIYFDVSMKARED
GAELRASLALDYLSGYFSLADDR
NT seq 432 nt   +upstreamnt  +downstreamnt
gtgagcgatcttcaactctacaacaagctgtcgaaacggattcgtcgccattcgctgcaa
gaggtcgtggccgaccacttggtcgatctgatgaatcacgcgatccgcggtgcgcgcatg
cgcatcgcggacgacagcccggccgcgcattcggtgctgaacttcggttgtccgccgatg
cagatggccggtgcgacgaagatcaatccggttcatgcggccgcgcatatctgcgaggtg
attcgccgcttcgagccgcgcgtggaccctgccagcacggtggtcaagccgcgcacggag
agccgcaagcgcctcgcgcagacgatttatttcgacgtgtcgatgaaggcgcgcgaagac
ggagccgaactcagggcgagcctcgcgctcgactatctgagtggttatttcagcctggcg
gacgaccgatga

DBGET integrated database retrieval system