KEGG   Burkholderia mallei SAVP1: BMASAVP1_0747
Entry
BMASAVP1_0747     CDS       T00457                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMASAVP1_0747
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmv02044]
    BMASAVP1_0747
Secretion system [BR:bmv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMASAVP1_0747
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABM49070
Position
II:complement(760822..761349)
AA seq 175 aa
MANALVDYFLQIDGVEGESTDQQYPGLIQIQSWQWAEENSGRWGFGSGGGAGKVEMKDFE
FRMVSNKASPKLFLMCATGEHIQNAKLICRKSGKGQQEFLTISFASGLVSSFRTLGNMPI
SQLGHASGEVDGVLPTDQIRINFVQIEFEYREQRNDGTMGAVIKAGYDLKQNAPI
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcaaatgctttggttgattacttcttgcagatcgatggcgtcgagggtgagtcgacc
gatcagcaatatcccggtctgatccagatccagagctggcagtgggcggaagagaactcg
ggccgctggggcttcggcagcggcggcggcgcgggcaaggtcgagatgaaggacttcgag
ttccgcatggtgtcgaacaaggcgtcgccgaagctgttcctgatgtgcgcgacgggtgag
cacatccagaatgcgaagctgatctgccgcaagtcgggcaagggccagcaggagttcctg
acgatctcgttcgcgagcggcctcgtgtcgtcgttccgcacgctcggcaacatgccgatc
tcgcagctcggtcacgcgagcggcgaagtcgacggcgtgctgccgacggatcagatccgc
atcaacttcgtccagatcgagttcgagtaccgcgagcagcgcaacgacggcacgatgggc
gccgtgatcaaggcgggctacgacctgaagcagaacgcgccgatctaa

DBGET integrated database retrieval system