KEGG   Burkholderia mallei SAVP1: BMASAVP1_0753Help
Entry
BMASAVP1_0753     CDS       T00457                                 

Definition
(GenBank) coenzyme A transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv00020  Citrate cycle (TCA cycle)
bmv00620  Pyruvate metabolism
bmv00650  Butanoate metabolism
bmv01100  Metabolic pathways
bmv01110  Biosynthesis of secondary metabolites
bmv01120  Microbial metabolism in diverse environments
bmv01130  Biosynthesis of antibiotics
bmv01200  Carbon metabolism
Module
bmv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMASAVP1_0753
   00620 Pyruvate metabolism
    BMASAVP1_0753
   00650 Butanoate metabolism
    BMASAVP1_0753
Enzymes [BR:bmv01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     BMASAVP1_0753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: ABM49449
Position
II:complement(767470..768984)
Genome map
AA seq 504 aa AA seqDB search
MPTSRILAPSLRSLVRTADEAAALIGPNMTVAMSGFTGSGYPKAVPAALAARIAASHARG
EDFRINVLTGASTAPELDGALAKADGISMRLPYQSDPTLREKINAGELDYQDIHLSHVAQ
YAWFGLFGELDVAIVEVAGIREDGRLIPSASVGNNKTWLDQAKRVILEVNARQPLGLDGM
HDIYYGTALPPNRKPIPLVKSDDRIGEPYLRCPAEKIVAIVETDAPDRSNAFAAPDETSK
QIAGLLIDFLRHEIKRGRLPEHLLPLQSGVGNITNAVLAGLGEGGFSNLSAYTEVIQDGM
LDLLANGTLSFASATALSLSPDAVKRFADEIDTFRSKIVLRPQEISNHPELVRRLGIIAM
NGMIEADIYGNVNSTHVMGTRIQNGIGGSGDFARNGYLSCFMSASTAKGGAISRIVPMAS
HVDHTEHDVAVVVTEQGLADLRGLSPKQRARKVIANCAHPDYRPMLEDYFERASRESFGK
QTPHLLGEALSWHERYVRTGSMKA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgccaacctctcgtatcctcgcccccagcctgcgctccctcgttcgcaccgccgacgag
gccgccgcgctgatcggcccgaacatgaccgtcgcgatgagcggcttcaccggctccggc
tatccgaaggcggtgccggccgcgctcgccgcgcggatcgcggcttcccacgcgcgcggc
gaagatttccgcatcaacgtgctgacgggcgcgtcgaccgcgcccgagctggacggcgcg
ctcgcgaaggcggacggtatctcgatgcggctgccgtaccagtccgatccgacgctgcgc
gagaagatcaacgcgggcgagctcgactatcaggacatccacctgagccacgtcgcgcag
tacgcgtggttcggcctgttcggcgagctggacgtcgcgatcgtcgaggtcgcgggcatt
cgcgaggacgggcgcctgattccgtcggcgtcggtcggcaacaacaagacgtggctcgac
caggccaagcgcgtgatcctcgaggtgaacgcgcgccagccgctcggtctcgacgggatg
cacgacatctattacggcaccgcgctgccgccgaaccgcaagccgattccgctcgtgaag
agcgacgaccggatcggcgagccgtatctgcgctgcccggccgagaagatcgtcgcgatc
gtcgagaccgacgcgccggaccgcagcaacgcgttcgccgcgccggacgagacctccaag
cagatcgccggactcctgatcgatttcctgcgtcacgagatcaagcgcggccgtctgccc
gaacacctgctgccgctgcagtccggcgtcggcaacatcacgaacgcggtgctcgccggc
ctcggcgaaggcggtttctcgaacctgagcgcgtatacggaagtgattcaggacggcatg
ctcgatctgctcgcgaacggtacgctgagcttcgcgtcggcgaccgcgctgtcgctcagc
ccggatgcggtgaagcgcttcgccgacgagatcgatacgttccgctcgaagatcgtgctg
cggccgcaggaaatcagcaaccatccggagctcgtgcggcgcctgggcatcatcgcgatg
aacgggatgatcgaggccgatatctacggcaacgtgaactcgacgcacgtgatgggcacg
aggattcagaacgggatcggcggctccggcgatttcgcgcgcaacggctatctgtcgtgc
ttcatgtcggcgagcactgccaagggcggcgccatttcgcggatcgtgccgatggcgagc
cacgttgaccataccgagcacgacgtcgcggtcgtcgtgaccgagcaggggctcgcggat
ctgcgtggactgtcgccgaagcagcgcgcgcgcaaggtcatcgcgaactgcgcgcatccc
gattaccggccgatgctcgaagactacttcgagcgcgcgagccgcgagagcttcggcaag
cagacgccgcatctgctcggcgaagcgctgtcgtggcacgagcgctacgtgcggaccgga
tcgatgaaagcctga

DBGET integrated database retrieval system