KEGG   Burkholderia mallei SAVP1: BMASAVP1_0917
Entry
BMASAVP1_0917     CDS       T00457                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11898  type VI secretion system protein ImpE
Organism
bmv  Burkholderia mallei SAVP1
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmv02044]
    BMASAVP1_0917
Secretion system [BR:bmv02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   BMASAVP1_0917
SSDB
Motif
Pfam: ImpE
Other DBs
NCBI-ProteinID: ABM48795
Position
II:complement(929673..930638)
AA seq 321 aa
MTTPAFPAPPGARTSARPHDTPLDARLAAAQAAVRARPVDAASRWALFQLLCVTGQGERA
VGQLQAYARFAAQHAHIAHAYRDLIRAERFHARVMAGQARPGFVFDAPPWIDDLLEALRA
QAAGARDEADRARSRALDRAPFVAGRGPDAPFDWIADSDSRFGPVCEVVTAGHDRWLPFS
DLAGWRLARPGVLLALVWAPCVLTLADGSVAHGFMPARYPGSELADGGGAPGASAAAHEA
DAHESAAREADALRLGSRTAWRDVGRTGVFALGRKTWSTSAGDAGLFELHACEFGARARA
GAVLGGAAREARGGEAADGCA
NT seq 966 nt   +upstreamnt  +downstreamnt
atgacgacgcctgccttcccggcgccgcccggcgcacgcacgtcggcccggccgcacgat
acgccgctcgacgcgcggctcgcggctgcgcaagccgcggtgcgcgcccggcccgtcgat
gcggcgagccgttgggcgctgtttcaactgctctgcgtgacgggccagggggaacgcgcc
gtcgggcagttgcaggcttatgcgcggttcgccgcgcagcacgcgcacatcgcgcacgcc
tatcgcgacctgattcgcgccgagcgctttcacgcccgcgtgatggcgggccaggcgcgg
ccgggattcgtattcgatgcgccgccgtggatcgacgatctgctggaagcgttgcgcgcg
caggcggccggcgcgcgcgacgaagccgaccgcgcgcgttcgcgcgcgctcgatcgcgcg
ccgttcgtcgcggggcgcgggccggatgcgccgttcgactggatcgccgacagcgattcg
cgattcgggccggtctgcgaagtcgtgaccgccgggcatgatcgttggctgccgttttcg
gatctggccggatggcggctcgcgcgcccgggcgtgctgctcgctctggtctgggcgccg
tgcgtgctcacgcttgccgacggcagtgtcgcgcacggcttcatgccagcgcgttacccg
ggctccgaactggccgacgggggcggcgcgccgggcgcctcagcggccgcgcacgaggcc
gatgcgcacgagagcgccgcgcgcgaggccgatgcgttgcggctcggcagccggaccgca
tggcgcgacgtcggccgcaccggcgtgttcgcgctcggccgcaagacctggtcgacgagc
gcgggcgacgccggccttttcgagctgcacgcgtgtgaattcggcgcgcgcgcccgtgcg
ggcgccgtgctcggcggcgcggcgcgcgaagcgcgcggcggggaggcggccgatggatgc
gcatga

DBGET integrated database retrieval system