KEGG   Burkholderia mallei SAVP1: BMASAVP1_0925
Entry
BMASAVP1_0925     CDS       T00457                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMASAVP1_0925
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmv02044]
    BMASAVP1_0925
Secretion system [BR:bmv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMASAVP1_0925
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ABM48814
Position
II:937670..938173
AA seq 167 aa
MHPTTPVAAVALALACAACASGAAKQKEPLRLELAVRAAPTVNPDDRSRPAPIVVSVYEL
KTDGAFNAADFFTLQGPDKTVLADDLLARERFQLRPGERRVIRRDADPAAGTLGVVAAYR
DLPNSVWRAAYPLPPARDAAWYRFSSPKLKLTIELDTHAIRITEPGK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcatccgaccacccccgttgccgccgtcgcgctcgcgctcgcgtgcgccgcgtgcgcg
agcggcgcggccaagcagaaggagccgctgcggctcgagctcgccgtgcgcgccgcgccc
acggtcaatccggacgatcggagccggccggctccgatcgtcgtgagcgtctacgagctg
aagaccgacggcgcattcaacgccgccgatttcttcacgctgcagggcccggacaagacc
gtgctcgccgacgatctgctcgcgcgcgagcgttttcaactgcgccccggcgagcgccgc
gtgatccggcgcgacgccgatccggcggcgggcacgctcggcgtggtcgccgcgtaccgc
gatctgccgaactcggtgtggcgcgcggcatatccgctgccgcccgcgcgggacgccgca
tggtatcgcttctcgtcgccgaagctgaagctgaccatcgagctcgacacgcacgcgatc
aggatcaccgaacccggaaaatga

DBGET integrated database retrieval system