KEGG   Burkholderia mallei SAVP1: BMASAVP1_0999Help
Entry
BMASAVP1_0999     CDS       T00457                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase family protein
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv00520  Amino sugar and nucleotide sugar metabolism
bmv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BMASAVP1_0999
Enzymes [BR:bmv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     BMASAVP1_0999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ABM48172
Position
II:1007202..1008248
Genome map
AA seq 348 aa AA seqDB search
MKDPERKRILVTGGAGFLGSHLCERLVAEGHDVLCVDNFYTGAKDNIAHLLDAPNFELMR
HDVTFPLYVEVDEIYNLACPASPVHYQRDPVQTTKTSVHGAINMLGLAKRLKARILQAST
SEVYGDPASHPQRESYWGHVNPVGIRACYDEGKRCAETLFVDYHRQYGVDIRIARIFNTY
GPRMHPADGRVVSNFIMQALADAPLTVYGDGRQTRAFCYVDDLIDALIRLMAAPGPMPEP
MNLGNAEEVSMLQIAREVVRVTGASVAIEFRPLPADDPRQRCPDLGFARERLGWRATTTL
ADGLAATVRYFIQRQAAHHAPGNLVHSTRVASHMLARVNAQGRSRVSA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaccccgaacgcaagcgcattctcgtcacgggcggcgccggctttctcggctcg
cacctgtgcgagcggctcgtcgccgaaggccacgacgtgctgtgcgtcgacaatttctac
accggcgcgaaggacaatatcgcgcatctgctcgacgcgccgaacttcgagctgatgcgg
cacgacgtgacgtttccgctgtacgtcgaggtcgacgagatctataacctcgcgtgcccc
gcatcgcccgtgcactaccagcgcgacccggtgcagacgacgaagacgagcgtgcacggc
gcgatcaacatgctcgggctcgcgaagcgcctgaaggcgcgcatcctgcaggcgtcgacg
agcgaagtgtacggcgacccggcgtcgcatccgcagcgcgagagctactggggccacgtg
aatcccgtcggcatacgcgcgtgctacgacgagggcaagcgctgcgcggagacgctgttc
gtcgactatcaccggcaatacggcgtcgacatccgcatcgcgcggatcttcaatacgtac
ggcccgcgcatgcatccggcggacgggcgcgtcgtgtcgaacttcatcatgcaggcgctc
gcggacgcgccgctcaccgtgtacggcgacggccggcaaacgcgtgcgttctgctacgtc
gacgacctgatcgacgcgctgatccgcctgatggccgcgcccggcccgatgcccgagccg
atgaacctcggcaatgccgaggaagtgtcgatgctgcagatcgcgcgcgaggtggtgcgc
gtgacgggcgcgtcggtcgcgatcgaattccggccgctgcccgccgacgatccgcgccag
cgctgcccggatctcggcttcgcgcgcgagcggctcggctggcgcgcgaccacgacgctc
gccgacgggctcgcggcaacggtgcgctacttcatccagcggcaggcggcgcatcacgcg
ccgggcaacctcgtgcacagcacgcgggttgcgtcgcacatgctcgcgcgcgtgaatgcg
caggggagatcgcgcgtcagcgcgtag

DBGET integrated database retrieval system