KEGG   Burkholderia mallei SAVP1: BMASAVP1_A0050Help
Entry
BMASAVP1_A0050    CDS       T00457                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMASAVP1_A0050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmv02044]
    BMASAVP1_A0050
Secretion system [BR:bmv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMASAVP1_A0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C
Motif
Other DBs
NCBI-ProteinID: ABM52863
Position
I:46051..49944
Genome map
AA seq 1297 aa AA seqDB search
MQRFLNVLTHPRTLTIVGFAALAAVLFIAADALQIGLVWAAVALGVALALWLATKLWRRW
RVRRANRQLGDMLEQQAETGKMSAAVAEPAKRAELDVLRTRLADTVKTIKTSKIGQVSGG
SALYELPWYIVIGNPAAGKSSAVINSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILL
DTAGRYSVHEEDRSEWLGFLDLLKRYRPKAPINGIIVTASIAELTGNRPEFAINLAKNLR
QRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSNDRQEYDRVWGATLPYEPDEKRDVV
ALFDQRFEELYDGLKEISVAQLSVSRGNKLSPGQLSFPLEFSTIKPALRSFLATLFEDNP
FQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGLDSQSLPKPHSAFSKNGFFLRDLFSK
VIFADRQTVRQFASPTKTRVRYATFFGFVAALALALGGWTWSTIGNQQLVSNVQADLDNV
TRLQQNRNDLQSRLQAMDILEDRIEQLEQFRRDKPLSVSLGLYQGNRLEQHLLTEYYNGV
RQILLAPVSDNLASFLKDVNAHPDQLAPMTRAPESGATPAGPMPVSTHPAAPGAAPSPAV
AQGRQQGGLYNDASPTNVEDAYNALKTYLMLSDKRHVEQAHLTDQVARFWRGWLETNRGN
MPRDEMIRSAERMITFYLSRVSDNDWPMIEANLALVDQTRENLRRVVRGMPARQRVYEEI
KARASTRFAPMTIARIVGEGNTGLVAGSYAIPGTFTRDAWFQYVQPAIRDAATKELQAKD
WVLNTASADDLTLEGSPEQIQKTLVAMYKTEYAQHWQKFMQGIAVQGFGNFTQAVDAMNK
LGDPQDSPIRKVLETAYDQTSWDNPSLANATIKKAQTGVVNWVKQWFTRQPGGQIAANVD
INGNPADVPMGPIGQEFVGLGRIVATHDGTSMLKGYMDTLSKVRTRFNVIKNQGDPGPGA
RQLMQQTLDGNGSELADSLKFVDEQMLTGLTDSQRKSLRPLLVRPLMQAFAVVIQPASVE
VNKVWNAQVYQPFQNSLANKYPFAAGAKVEAGAGEIAQVFGPDGSIAKFVGTTLGPLAVR
RGDTLSARTWGDMGLALTPDFTGGFARWVAPLAGGAATSAAASSEPQTVFQVLPQPSSGT
TEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGSPGATLSATTFDGRTLQLVNEPGRYGLEK
LINSAQRKRRPDGTFDLTWTQGSVSVSVTMRIISTSQPTGGGDQPQQQSLRGLRLPSSVA
DASAGGAANATAQPGSGAAAAQVAATAASASNAQGAQ
NT seq 3894 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcttcctcaacgtgttgactcaccctcgcacgctcacgatcgtcggcttcgcc
gcgctcgcggcggttctgttcatcgcggccgacgcgctccagatcggcctcgtatgggcg
gccgtcgcgctcggtgtcgcgctcgcgctctggctcgcgacgaagctctggcgccgctgg
cgcgtgcgccgcgcgaaccgccagctcggcgacatgctcgagcagcaggccgaaacgggc
aagatgtccgccgccgtggccgagcccgcgaagcgcgcggagctcgacgtgctgcgcacc
cgcctcgccgacacggtgaagacgatcaagacttcgaaaatcggccaggtgtcgggcggc
tccgcgctgtacgaactgccgtggtacatcgtgatcggcaatccggccgcgggcaagagc
agcgccgtcatcaactcggggttgcagtttccgttcgcggacaagaacagcgcggtgatc
cacggcatcggcggcacgcgcaactgcgactggttcttcacgaccgaaggcatcctgctc
gacaccgcgggccgctattcggtgcacgaggaagaccgcagcgaatggctcggctttctc
gatctgctcaagcgctatcgcccgaaggccccgattaacggcatcatcgtgacggcgagc
atcgccgagctcaccggcaatcgccccgaattcgcgatcaacctcgcgaaaaacctgcgc
cagcgcgtgcaggagctcaccgagaagctcgaagtgttcgcgcccgtctacgtgatgttc
acgaaggccgacctgatcacgggcttcaccgaattcttcagcagcaacgatcgccaggaa
tacgaccgcgtgtggggcgcgacgctgccgtacgagcctgacgagaagcgcgacgtggtc
gcgctgttcgatcagcgcttcgaggaactgtatgacgggctcaaggaaatcagcgtcgcg
cagctgtcggtgagccgcggcaacaagctctcgcccggccagttgagcttcccgctcgaa
ttttcgacgatcaagcccgcgctgcgctcgttcctcgcgacgctgttcgaggacaacccg
ttccagtacaagccgatcttccgcggcttctacttcacgagcgcgctgcaggaaggcgaa
acgaacagcgcggccgcgcagcggatcgcgcaccgcttcgggctcgattcgcaaagcctg
ccgaagccgcacagcgcgttctcgaagaacggcttcttcctgcgcgacctgttttcgaag
gtgatcttcgccgatcgccagacggtccgccagttcgcgagcccgacgaagacgcgcgtg
cgctacgcgacgttcttcggcttcgtcgcggcgctcgcgctcgcgctcggcggctggacc
tggtcgacgatcggcaaccagcagctcgtctcgaacgtgcaggccgacctcgacaacgtg
acccgcctgcagcagaaccgcaacgatctgcaatctcgcctgcaggcgatggacatcctc
gaggatcggatcgagcagctcgagcagttccggcgcgacaagccgctgtccgtctcgctc
ggcctgtatcagggcaatcggctcgagcagcacctgttgaccgagtactacaacggcgtg
cggcagatcctgctcgctcccgtgtcggacaatctcgcgtcgttcctgaaggacgtgaac
gcgcatccggaccagctcgcgccgatgacgcgcgcgcccgaatcgggcgcgacgccggcc
ggcccgatgccggtatcgacccatcccgcggcgccgggcgcggccccctcccccgccgtc
gcgcagggccggcagcagggcggcctctataacgacgcgtcgccgaccaacgtcgaggac
gcgtacaacgcgctgaagacctacctgatgctctccgacaagcggcacgtcgagcaggcg
cacctgaccgatcaggtcgcgcgcttctggcgcggctggctcgagacgaatcgcggcaac
atgccgcgcgacgagatgatcaggagcgcggagcgaatgatcacgttctacctgtcgcgc
gtgtccgacaacgactggccgatgatcgaggcgaatctcgcgctcgtcgaccagacccgc
gagaacctgcgccgcgtcgtgcgcggcatgccggcccgccagcgcgtgtatgaagagatc
aaggcgcgcgcgtcgacccgcttcgcgccgatgacgatcgcgcgcatcgtcggcgaaggc
aacaccggcctcgtcgcgggcagctacgcgatccccggcacgttcacgcgcgacgcgtgg
ttccagtacgtgcagccggcgatccgcgacgccgcgacgaaggagctgcaggcgaaggat
tgggtgctgaacaccgcgtcggcggacgatctgacgctcgagggcagccccgagcagatc
cagaaaacgctcgtcgcgatgtacaagaccgagtacgcacagcactggcagaagttcatg
cagggcatcgcggtgcagggcttcggcaatttcacgcaggcggtcgacgcgatgaacaag
ctcggcgatccgcaggattcgccgatccgcaaggtgctcgagaccgcgtacgaccagacc
tcgtgggacaacccgtcgctcgcgaacgcgacgatcaagaaggcgcagacgggcgtcgtg
aactgggtcaagcagtggttcacgcgccagccgggcggccagatcgcggcgaacgtcgac
atcaacggcaatcccgccgacgtgccgatgggcccgatcggtcaggagttcgtcgggctc
ggccggatcgtcgccacgcacgacggcacgtcgatgctcaagggctacatggacacgctg
tcgaaggtccgtacgcgctttaacgtgatcaagaaccagggcgaccccggccccggcgcg
cgtcagctgatgcagcagacgctcgacggcaacggctcggagctcgccgattcgctgaag
ttcgtcgacgagcagatgctcacgggcttgaccgattcgcaacgcaaatcgctgcgcccg
cttctcgtgcgcccgctgatgcaggcgttcgcggtcgtgatccagccggcgagcgtcgag
gtgaacaaggtatggaacgcgcaggtgtaccagccgttccagaactcgctcgcgaacaag
tatccgttcgcggcgggcgcgaaggtcgaggcgggcgcgggcgagatcgcgcaggtgttc
ggccccgacggctcgatcgcgaagttcgtcggcacgacgctcggcccgctcgcggtgcgc
cgcggcgacacgctgtccgcgcgcacctggggcgacatgggcctcgcgctcacgccggac
ttcacgggcggcttcgcgcgctgggtcgcgccgctcgcgggcggcgcggcgacgagcgcg
gccgcgtcgtccgagccgcagaccgtgttccaggtgctgccgcagccgagcagcggcacg
accgaatacacgatcgcgatcgacggccagcagctgcgctaccgcaacacgccgccgcaa
tggacgaacttcgtgtggccgaacccgcagggctcgcccggcgcgacgctgtccgcgacg
accttcgacggccgcacgttgcagctcgtcaacgagccgggccgctacggcctcgagaag
ctgatcaactcggcgcagcgcaagcgccgtccggacggcacgttcgatctgacatggacg
cagggcagcgtcagcgtctcggtgacgatgcgcatcatcagcacctcgcagccgacgggc
ggcggcgatcagccgcagcagcaaagcctgcgcggcctgcgcctgccttcgtcggtcgcc
gacgcgagcgcgggcggcgcggccaatgcgacggcgcaacccggctcgggcgccgcggcc
gcgcaggtcgccgccacggccgcttccgcatcgaacgcacagggggcgcaatga

DBGET integrated database retrieval system