KEGG   Burkholderia mallei SAVP1: BMASAVP1_A0188Help
Entry
BMASAVP1_A0188    CDS       T00457                                 

Gene name
gshB
Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv00270  Cysteine and methionine metabolism
bmv00480  Glutathione metabolism
bmv01100  Metabolic pathways
Module
bmv_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BMASAVP1_A0188 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BMASAVP1_A0188 (gshB)
Enzymes [BR:bmv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     BMASAVP1_A0188 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ABM52858
Position
I:complement(190872..191828)
Genome map
AA seq 318 aa AA seqDB search
MDILFIADPLDRFKIYKDSTYAMMAEAARRGHAVYACEPNQLAWTGAGVEADVRRVTIAG
DTADLHRDRWYEAAARESRALPSFGAILMRKDPPFDMEYVTSTWLLELAERAGARVFNKP
QTIRDHSEKLAIGEFAQFVAPSLVTRDAARLRAFHAEHGDVILKPLDGMGGMGVFRVKAD
GMNLGSIIEMLSHDGARSVMVQKFIPEIKAGDKRILLIDGEPVPYSLARIPQGSEVRGNL
AAGGVGVAQPLTERDREIAAALGPVLAARGLLLVGLDVIGDWLTEVNVTSPTCFREIMEQ
TGFDVAGMFVDALERAVG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggacattctctttatcgccgacccgctcgatcgcttcaagatctacaaggactcgacc
tacgcgatgatggccgaggccgcgcggcgcgggcacgcggtgtacgcgtgcgagccgaac
cagcttgcgtggacgggcgcgggcgtcgaggccgacgtgcgccgcgtgacgatcgcgggc
gacacggccgatctgcaccgcgatcgctggtacgaggcggcggcgcgcgagtcgcgcgcg
ctgccttcgttcggtgcgatcctgatgcgcaaggatccgccgttcgacatggaatacgtg
acgtcgacgtggctgctcgagctcgccgagcgtgcgggcgcgcgcgtgttcaacaagccg
cagacgattcgcgatcattccgagaagctcgcgatcggcgagttcgcgcaattcgtcgcg
ccgtcgctcgtcacgcgtgacgcggcgcggctgcgcgcgttccacgccgagcacggcgac
gtgatcctgaagccgctcgacggcatgggcgggatgggcgtgtttcgcgtgaaggcggac
ggcatgaacctcggctcgatcatcgagatgctgagccacgacggcgcgcgctcggtgatg
gtgcagaagttcatccccgagatcaaagccggcgacaagcgcattctgctgatcgacggt
gagccggtgccgtactcgctcgcgcggattccgcagggcagcgaggtgcgcggcaacctg
gcggcgggcggcgtcggggtcgcgcagccgctcaccgagcgcgaccgcgagattgcggcg
gcgctcggcccggtgctcgccgcgcgcggcttgctgctcgtcggcctcgacgtgatcggc
gactggctgaccgaggtgaacgtcacgagcccgacttgctttcgcgaaatcatggagcaa
actggattcgacgtcgccggcatgttcgtcgacgcattggagcgcgcggtcggttga

DBGET integrated database retrieval system