KEGG   Burkholderia mallei SAVP1: BMASAVP1_A0957Help
Entry
BMASAVP1_A0957    CDS       T00457                                 

Definition
(GenBank) class II aldolase/adducin domain protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv00051  Fructose and mannose metabolism
bmv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BMASAVP1_A0957
Enzymes [BR:bmv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BMASAVP1_A0957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ABM52592
Position
I:complement(952003..952785)
Genome map
AA seq 260 aa AA seqDB search
MVDTLKMGKAELVALAQRRLDNEIKDSGWSAREKLALTCRILFDDGHDSGLAGQITCRAD
APHTYYTQRLGLGFDEIAESNLLQVDQDLEVIGGQGIPNPANRFHTWIYRARPDVNCIIH
THPTHVAALSMLETPLVVSHMDTCPLHGDCAFLKDWPGVPVGNEEGEIISNALGDKRAIL
LSHHGQLVVGKTIEEACMLAILIERAARLQLLAIAAGAIAPIPPALAADAHDWISTPKRD
AVTFAYYARRALRRHPDCLD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacacattgaagatgggcaaggccgagctcgtcgcgctcgcgcagcggcggctc
gacaacgagatcaaggacagcgggtggagcgcgcgcgagaagctcgcgctcacctgccgg
atcctgttcgacgacgggcacgactccggcctcgccgggcagatcacgtgccgcgccgac
gcgccgcacacgtactacacgcagcgcctcgggctcggcttcgacgagatcgccgaatcg
aacctgctgcaggtcgatcaggatctcgaggtcatcggcggccagggcattccgaatccc
gcgaaccgctttcacacgtggatttatcgcgcgcgccccgacgtcaactgcatcatccac
acgcacccgacgcacgtcgccgcgctgtcgatgctcgagacgccgctcgtcgtgtcgcac
atggacacctgtccgcttcacggcgactgcgcgttcctgaaggattggccgggcgtgccc
gtcggcaacgaggaaggcgagatcatctcgaacgcgctcggcgacaagcgcgcgatcctg
ctgtcgcatcacggccagctcgtcgtcggcaagacgatcgaagaggcgtgcatgctcgcg
atcctgatcgagcgcgcggcgcggctgcaactgctcgcgatagcggccggcgcgatcgcg
ccgattccgcccgcgctcgcggccgacgcgcacgactggatctcgacgcccaagcgcgac
gcggtgaccttcgcgtactacgcgcgccgcgcgctacgccgccaccccgactgcctcgac
tga

DBGET integrated database retrieval system