KEGG   Burkholderia mallei SAVP1: BMASAVP1_A1743Help
Entry
BMASAVP1_A1743    CDS       T00457                                 

Gene name
rpiA
Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv00030  Pentose phosphate pathway
bmv00710  Carbon fixation in photosynthetic organisms
bmv01100  Metabolic pathways
bmv01110  Biosynthesis of secondary metabolites
bmv01120  Microbial metabolism in diverse environments
bmv01130  Biosynthesis of antibiotics
bmv01200  Carbon metabolism
bmv01230  Biosynthesis of amino acids
Module
bmv_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMASAVP1_A1743 (rpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BMASAVP1_A1743 (rpiA)
Enzymes [BR:bmv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     BMASAVP1_A1743 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A Sugar-bind DeoRC
Motif
Other DBs
NCBI-ProteinID: ABM49708
UniProt: A1V4B2
Position
I:complement(1726269..1726964)
Genome map
AA seq 231 aa AA seqDB search
MTQDELKRLVGEAAARYVTENVPQGAVIGVGTGSTANCFIDALAAVKDRYRGAVSSSVAT
TERLKSHGIKVFDLNEIESLQVYVDGADEIDGSGAMIKGGGGALTREKIVASVAETFVCI
ADASKRVAVLGQFPLPVEVVPMARTAIGRRLAALGGVPVLRVKQDGAPYVTDNGNEILDV
KGLRIDDPRALEAAINGWPGVVTVGLFAQRGADLCLLGTERGVETLRYAAH
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagacgaactcaaacgcctcgtcggcgaggccgctgcccgatacgtgaccgaa
aacgtgccgcagggcgcggtgatcggcgtcggcacgggctcgaccgccaactgcttcatc
gatgcgctcgcggccgtcaaggatcgctatcgcggcgcggtgtcgagttcggtggcgacg
accgagcgcctgaagtcacacggcatcaaggtgttcgatctgaacgagatcgaatcgctg
caggtgtatgtcgacggcgccgacgagatcgacgggagcggcgcgatgatcaagggcggc
ggcggcgcgctcacgcgcgagaagatcgttgcttcggttgccgaaacgttcgtgtgcatc
gccgatgcgagcaagcgcgtggcggtgctcggccagttcccgctgcccgtcgaggtggtg
ccgatggcgcgcaccgcgatcggccgccggctcgccgcgctgggcggcgtgcccgtgctg
cgcgtgaagcaggacggcgcgccgtacgtgaccgacaacggcaacgagattctcgacgtg
aagggcctgcggatcgacgatccgcgcgcgctcgaagcggcgatcaacggctggcccggc
gtcgtgacggtcgggctgttcgcgcaacgcggcgcggatctctgcctgctcggcaccgag
cgcggcgtcgagacgctccgttacgctgcgcattaa

DBGET integrated database retrieval system