KEGG   Burkholderia mallei SAVP1: BMASAVP1_A1805Help
Entry
BMASAVP1_A1805    CDS       T00457                                 

Gene name
bktB
Definition
(GenBank) beta-ketothiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv00071  Fatty acid degradation
bmv00072  Synthesis and degradation of ketone bodies
bmv00280  Valine, leucine and isoleucine degradation
bmv00310  Lysine degradation
bmv00362  Benzoate degradation
bmv00380  Tryptophan metabolism
bmv00620  Pyruvate metabolism
bmv00630  Glyoxylate and dicarboxylate metabolism
bmv00640  Propanoate metabolism
bmv00650  Butanoate metabolism
bmv00900  Terpenoid backbone biosynthesis
bmv01100  Metabolic pathways
bmv01110  Biosynthesis of secondary metabolites
bmv01120  Microbial metabolism in diverse environments
bmv01130  Biosynthesis of antibiotics
bmv01200  Carbon metabolism
bmv01212  Fatty acid metabolism
bmv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMASAVP1_A1805 (bktB)
   00630 Glyoxylate and dicarboxylate metabolism
    BMASAVP1_A1805 (bktB)
   00640 Propanoate metabolism
    BMASAVP1_A1805 (bktB)
   00650 Butanoate metabolism
    BMASAVP1_A1805 (bktB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMASAVP1_A1805 (bktB)
   00072 Synthesis and degradation of ketone bodies
    BMASAVP1_A1805 (bktB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMASAVP1_A1805 (bktB)
   00310 Lysine degradation
    BMASAVP1_A1805 (bktB)
   00380 Tryptophan metabolism
    BMASAVP1_A1805 (bktB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMASAVP1_A1805 (bktB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMASAVP1_A1805 (bktB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMASAVP1_A1805 (bktB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmv04147]
    BMASAVP1_A1805 (bktB)
Enzymes [BR:bmv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMASAVP1_A1805 (bktB)
Exosome [BR:bmv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMASAVP1_A1805 (bktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABM50024
Position
I:complement(1789414..1790697)
Genome map
AA seq 427 aa AA seqDB search
MSPRARRAIRMHDVRGRDRALHRFSSREEREATMQREVVVVSGVRTAIGDFGGSLKDFAP
TELGARVVREVLSRAQVSGDEVGHVVFGNVVHTEPKDMYLARVAAINGGVAQHAPALTVN
RLCGSGLQAIVSAAQNVLLGDADIAVAGGAENMSRAPYSVPAARFGQRMGDAKLVDMMIG
ALNDPFQSIHMGVTAENVAAKYGITRDAQDALALESHRRASHATKSGYFKDQILPIEIAS
RKGTVVFDADEHVRHDASLDDFTKLKPVFAKENGTVTAGNASGINDAAAAVVLMERGVAD
KRGAKPLARLVSYAHAGVDPAYMGIGPVPATKKALERAGITVADLDVIEANEAFAAQACA
VSNALGLDPAKVNPNGSGISLGHPIGATGALITVKALYELQRIGGRYALVTMCIGGGQGI
AAVFERL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccgcgcgcgcggcgcgcgatccgaatgcatgacgtgcgcggccgcgaccgcgcg
ctccatcggttttcatcaagagaagagagggaggcaacgatgcaacgcgaagtagtggtg
gtgagcggcgtacgcacggcgatcggcgatttcggcggcagcctgaaggacttcgcgccg
accgagctcggcgcgcgggtcgtgcgcgaggtgctgtcgcgcgcgcaggtgtcgggcgac
gaggtcggccacgtcgtgttcggcaatgtcgtgcacacggagccgaaggacatgtatctc
gcgcgcgtcgcggcgatcaacggcggcgtcgcgcagcacgcgcccgcgctgacggtcaac
cgtctctgcggctccggcctgcaggcgatcgtgtcggccgcgcagaacgtgctgctcggc
gacgcggacatcgcggtcgcgggcggcgcggagaacatgagccgcgcgccgtactcggtg
ccggccgcgcgcttcggccagcgcatgggcgatgcgaagctcgtcgacatgatgatcggc
gcgctcaacgatccgttccagtcgattcacatgggcgtgacggccgagaacgtcgcggcg
aagtacgggatcacgcgcgacgcgcaggacgcgctcgcgctcgaatcccaccggcgcgcg
tcgcatgcgacgaaatccggctatttcaaggatcagatcctgccgatcgagatcgcgtcg
cgcaagggcacggtcgtgttcgacgccgacgagcacgtgcgccacgacgcgtcgctcgac
gacttcacgaagctcaagcccgtgttcgccaaggagaacggcacggtgacggcgggcaac
gcgtcgggcatcaacgatgcggccgccgcggtggtgctgatggagcgcggcgtcgccgac
aagcgcggcgcgaagccgctcgcgcgcctcgtctcgtatgcgcacgcgggcgtcgatccg
gcatacatgggcatcggccccgtgcccgcgacgaagaaggcgctcgagcgcgcgggcatc
accgtcgccgatctcgacgtgatcgaggcgaacgaggcgttcgccgcgcaggcgtgcgcg
gtgtcgaacgcgctcggtctcgatccggcgaaggtcaacccgaacggctcgggcatctcg
ctcggccatccgatcggcgcgacgggcgcgctcatcaccgtgaaggcgctgtacgagctg
cagcggatcggcgggcgctacgcgctcgtcacgatgtgcatcggcggcgggcagggcatt
gccgcggtgttcgagcgtctgtga

DBGET integrated database retrieval system