KEGG   Burkholderia mallei SAVP1: BMASAVP1_A1847Help
Entry
BMASAVP1_A1847    CDS       T00457                                 

Gene name
surE
Definition
(GenBank) acid phosphatase SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv00230  Purine metabolism
bmv00240  Pyrimidine metabolism
bmv00760  Nicotinate and nicotinamide metabolism
bmv01100  Metabolic pathways
bmv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BMASAVP1_A1847 (surE)
   00240 Pyrimidine metabolism
    BMASAVP1_A1847 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BMASAVP1_A1847 (surE)
Enzymes [BR:bmv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     BMASAVP1_A1847 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: ABM50694
UniProt: A1V4L3
Position
I:complement(1833938..1834699)
Genome map
AA seq 253 aa AA seqDB search
MRILLSNDDGYLAPGLAALYEALRPLAEILVMAPEQNCSGASNSLTLSRPLSVSRSAATG
FYYVNGTPTDSVHVALTGMLDTKPDLVVSGINNGQNMGDDTLYSGTVAAATEGIMFGVPA
IAFSLVHKEWAHLGDAARVAAEIVRHYLDHPLPGQPLLNVNIPNLPYEELKGWRVTRLGK
RHPSQPVIRQTNPRGEPIYWIGAAGDALDASEGTDFHATASGYVSITPLQLDLTHTQMLG
ATRDWARAGSGAS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatactactcagcaacgacgacggataccttgcgcccggcctcgccgcgctgtac
gaagcgctgcgcccgctcgccgagatcctcgtgatggcgcccgagcagaactgcagcggc
gcgtcgaactcgctcacgctgtcgcgcccgctctcggtgtcgcgttcggccgccacgggt
ttctactacgtgaacggcacgccgaccgattcggtgcacgtcgcgctgacaggcatgctc
gacacgaagcccgatctcgtcgtatcggggatcaacaacggccagaacatgggcgacgat
acgctgtattccggcacggtcgccgcggcgacggaaggcatcatgttcggcgtgccggca
atcgcgttctcgctcgttcacaaggagtgggcgcacctcggcgatgcggcgcgcgtcgcg
gccgagatcgtgcgtcattacctcgaccatccgctgcccggccagccgctgctgaacgtc
aacatcccgaacctgccgtacgaagagctgaagggctggcgcgtgacgcggctcggcaag
cgccatccgtcgcagccggtgattcgccaaaccaacccgcgcggtgagccgatctactgg
atcggtgcggcgggcgacgcgctcgacgcgagcgagggcaccgattttcacgcgaccgcg
tcgggctacgtgtcgatcacgccgctgcagctcgatctcacgcatacgcagatgctcgga
gccacgcgcgattgggcgcgtgccgggagcggcgcttcatga

DBGET integrated database retrieval system