KEGG   Burkholderia mallei SAVP1: BMASAVP1_A1874Help
Entry
BMASAVP1_A1874    CDS       T00457                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv00260  Glycine, serine and threonine metabolism
bmv00750  Vitamin B6 metabolism
bmv01100  Metabolic pathways
bmv01110  Biosynthesis of secondary metabolites
bmv01120  Microbial metabolism in diverse environments
bmv01230  Biosynthesis of amino acids
Module
bmv_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMASAVP1_A1874 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BMASAVP1_A1874 (thrC)
Enzymes [BR:bmv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BMASAVP1_A1874 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABM50580
Position
I:complement(1859076..1860527)
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPSEYPRVSADELARWRALPYADLAFEI
LAKFCDDIPADDLRAITRRTYTADVYRHTRHGGNAADITPLTTLGAENGAPVSLLELSNG
PTLAFKDMAMQLLGNLFEYTLAAHGETLNILGATSGDTGSAAEYAMRGKRGVRVFMLSPH
RKMSAFQTAQMYSLQDPNIFNLAVKGVFDDCQDIVKAVSNDHAFKAQQKIGTVNSINWAR
VVAQVVYYFKGYFAATRTNDERVSFTVPSGNFGNVCAGHIARMMGLPIEKLVVATNENDV
LDEFFRTGAYRVRSAEHTYHTSSPSMDISKASNFERFVFDLLGRDPARVVQLFRDVEQKG
GFDLAASGDFARVAEFGFVSGRSTHADRLATIRDVFERYRTTIDTHTADGLKVAREHLQP
GVPMIVLETAQPIKFGETIREALGREPSRPAAFDGLEALPQRFEVVDASAQQVKDFIAAH
TGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaattacatctccacgcgcggcgccggcatcggcgagcgtcacacgttctccgacatc
ctgctcggcggcctcgcgaaggacggcgggctctacctgccgagcgagtatccgcgggtg
agcgcggacgagctcgcgcgctggcgcgcgctgccgtacgcggatctcgcgttcgagatc
ctcgcgaagttctgcgacgacatcccggccgacgacctgcgcgcgatcacgcgccgcacg
tatacggccgacgtctatcgtcacacgcgccacggcggcaacgcggccgacatcacgccg
ctcacgacgctcggtgccgagaacggcgcgccggtctcgctgctcgaactgtcgaacggc
ccgacgctcgcgttcaaggacatggcgatgcagttgctcggcaacctgttcgagtacacg
ctcgccgcgcacggcgaaacgctgaacatcctcggcgcgacgtcgggcgatacgggcagc
gcggccgaatacgcgatgcgcggcaagcggggcgtgcgcgtgttcatgctgtcgccgcac
cggaagatgagtgcgttccagacggcccagatgtacagcctgcaggacccgaacatcttc
aacctcgcggtgaagggcgtgttcgacgattgccaggacatcgtgaaggccgtgtcgaac
gatcacgcgttcaaggcgcagcagaagatcggcacggtcaattcgatcaactgggcgcgt
gtcgtcgcgcaggtcgtgtactacttcaagggctatttcgcggcgacgcgcacgaacgac
gagcgcgtgtcgtttacggtgccgtcgggcaacttcggcaatgtctgcgcgggccacatc
gcgcggatgatggggctgccgatcgagaagctcgtcgtcgcgaccaacgagaacgacgtg
ctcgacgaattcttccgcacgggtgcgtatcgcgtgcgcagcgccgagcacacgtaccac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgagcgcttcgtgttcgac
ctgctcggccgcgatccggcgcgcgtcgttcagctgtttcgcgacgtcgagcaaaagggt
ggcttcgatctcgcggcgagcggcgatttcgcgcgcgtcgccgagttcggcttcgtgtcg
ggccgcagcacgcacgcggaccggctcgcgacgatccgcgacgtgttcgagcgctatcgc
acgacgatcgacacgcacacggccgacggcctgaaagtggcgcgcgagcatctgcagccg
ggcgtgccgatgatcgtgctcgagaccgcgcagccgatcaagttcggcgaaacgattcgc
gaggcgctcgggcgggagccgtcgcggcccgccgcgttcgacgggctcgaggcgttgccg
cagcgcttcgaggtggtcgacgcgagcgcgcagcaggtgaaggacttcatcgccgcgcac
acgggcgcatga

DBGET integrated database retrieval system