KEGG   Burkholderia mallei SAVP1: BMASAVP1_A2088Help
Entry
BMASAVP1_A2088    CDS       T00457                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv00630  Glyoxylate and dicarboxylate metabolism
bmv01100  Metabolic pathways
bmv01110  Biosynthesis of secondary metabolites
bmv01120  Microbial metabolism in diverse environments
bmv01200  Carbon metabolism
Module
bmv_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BMASAVP1_A2088 (aceA)
Enzymes [BR:bmv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BMASAVP1_A2088 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABM52370
Position
I:2067483..2068910
Genome map
AA seq 475 aa AA seqDB search
MPRLLYKTSRTKPPNPNRAVRFAQSKISSLQATTTQGVRIMSRQQQAQELQKQWETDPRW
KGIKRAFTAEDVVRLRGSIQQEHTLAKRGAEKLWTLINNEPFVNALGALTGNQAMQQVKA
GLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKRINNTLTRADQIQWSEGKNPG
DEGYVDFFAPIVADAEAGFGGVLNAFELMKAMIEAGASGVHFEDQLASVKKCGHMGGKVL
VPTREAVAKLTAARLAADVMGTPTVLVARTDAEAADLITSDIDDNDKPYLTGERTVEGFF
RTKPGLEQAISRGLAYAPYADLIWCETGKPDLEYAKKFAEAIHKQFPGKLLSYNCSPSFN
WKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMFNLAHGYARTQMSAFVELQQA
EFAAADKGFTAVKHQREVGTGYFDAVTQTVEREASTTALHGSTEDEQFFDGQKVA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgcctagactcttatacaagacttcacgaacgaaaccgccgaatcccaatcgcgccgtc
cgtttcgcccagtcaaagatttcttctcttcaggcaacgaccactcaaggagtacgcatc
atgtcgcgtcaacaacaggctcaggaactgcaaaagcaatgggaaaccgatccgcgctgg
aagggcatcaagcgcgcgttcaccgctgaggacgtcgtgcgcctgcgcggctcgatccag
caagagcacacgctcgcgaagcgcggcgcggaaaagctctggacgctcatcaacaacgag
ccgttcgtcaacgcactcggcgcgctgacgggcaaccaggcgatgcagcaggtcaaggcc
ggcctcaaggcgatctatctgtcgggctggcaagtcgcgggcgacgcgaacgtcgcgggc
gaaatgtatccggaccagtcgctgtacccggcgaactcggtgccgctcgtcgtcaagcgc
atcaacaacacgctcacgcgcgccgatcagatccagtggtcggaaggcaagaaccccggc
gacgaaggctatgtcgacttcttcgcgccgatcgtcgccgacgcggaagccggcttcggc
ggcgtgctgaacgcgttcgaactgatgaaggcgatgatcgaggcgggcgcgtcgggcgtt
cacttcgaagaccagctcgcctcggtcaagaagtgcggccacatgggcggcaaggtgctc
gtgccgacccgcgaggcggtcgcgaagctgacggccgcgcgtctcgccgccgacgtgatg
ggcacgccgaccgtgctggtcgcgcgcaccgacgccgaagcggccgacctgatcacgtcc
gacatcgacgacaacgacaagccgtacctgacgggcgagcgcacggtcgaaggcttcttc
cgcacgaagccgggcctcgagcaggcgatctcgcgcggcctcgcctatgcgccgtacgcc
gacctgatctggtgcgaaaccggcaagccggatctcgaatacgcgaagaagttcgcggaa
gcgatccacaagcagttcccgggcaagctgctgtcgtacaactgctcgccgtcgttcaac
tggaagaagaacctcgacgacgcgacgatcgcgaagttccagaaggaactcggcgcgatg
ggctacaagttccagttcatcacgctcgccggcttccatgcgctgaactactcgatgttc
aacctcgcgcacggctacgcccgcacgcagatgagcgcgttcgtcgaactgcagcaagcc
gagttcgcggcggccgacaagggcttcaccgcggtcaagcaccagcgtgaagtcggcacc
ggctacttcgacgcggtgacgcagacggtcgagcgcgaagcgtcgacgaccgcgctgcac
ggctcgaccgaagacgaacagttcttcgacggccagaaagtcgcctga

DBGET integrated database retrieval system