KEGG   Burkholderia mallei SAVP1: BMASAVP1_A2229Help
Entry
BMASAVP1_A2229    CDS       T00457                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv00010  Glycolysis / Gluconeogenesis
bmv00020  Citrate cycle (TCA cycle)
bmv00620  Pyruvate metabolism
bmv01100  Metabolic pathways
bmv01110  Biosynthesis of secondary metabolites
bmv01120  Microbial metabolism in diverse environments
bmv01130  Biosynthesis of antibiotics
bmv01200  Carbon metabolism
Module
bmv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMASAVP1_A2229 (aceF)
   00020 Citrate cycle (TCA cycle)
    BMASAVP1_A2229 (aceF)
   00620 Pyruvate metabolism
    BMASAVP1_A2229 (aceF)
Enzymes [BR:bmv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BMASAVP1_A2229 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: ABM51315
Position
I:complement(2210975..2212564)
Genome map
AA seq 529 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKPGDAVEPEQSLVTLESDKATMDVPSPSAGTVKEV
KVKVGDAVSQGSLIVLLDGAQAAAQPAQANGAATSAAQPAAAPAAAPAPAAAAGGGTVDV
KVPDIGDYKDVPVIEIAVKIGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKVGDA
VSEGSLIVVLEASGGAAASAPQAAPAAAPAPAQAPAPAASGEYRASHASPSVRKFARELG
VDVSRVTGTGPKSRITKDDVTAFVKGVMTGQRAAPGAAAAPAGGGELNLLPWPKVDFSKF
GPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITELEALRVQLNKEHEKAGVKFTM
LAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADTPNGLVVPVIRDADKKGLVD
IAKEMAELSKAAREGKLKPDQMQGGCFSISSLGGIGGTHFTPIINAPEVAILGLSRGQMK
PVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFNAYLGALLADFRRIIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaagtgctcgtgaagccgggcgatgcggtcgagcccgagcagtcgctcgtcacgctc
gaatcggacaaggcgacgatggatgtgccgagcccgtcggcgggcacggtcaaggaagtg
aaggtgaaggtcggcgacgcggtgtcgcaaggctcgctgatcgtgctgctcgacggcgcg
caggcggcggcccagcccgcgcaggcgaacggcgccgcgacgagcgccgcgcagccggcg
gcggcgcccgctgccgcgcctgcgccggcggcggccgcgggcggcggcacggtcgacgtg
aaggtgccggacatcggcgactacaaggacgtgcccgtcatcgagatcgccgtgaagatc
ggcgacacggtcgagaaggagcagtcgctcgtcacgctcgaatcggacaaggcgacgatg
gacgtgccgagcccggccgcgggcgtcgtcaaggacatcaaggtaaaggtcggcgatgcg
gtgtcggaaggttcgctgatcgtcgtgctcgaagcgtcgggcggcgccgccgcgagcgcg
ccgcaggccgcacccgcggctgcgccggcccccgcgcaggcaccggcacccgccgcgagc
ggcgagtaccgcgcgagccacgcgtcgccgtcggtgcgcaagttcgcgcgcgagctcggc
gtcgacgtgtcgcgcgtcacgggcacggggccgaagagccgcatcacgaaggacgacgtc
accgcgttcgtgaagggcgtgatgacggggcagcgcgcggcgcccggcgctgcggccgcg
cccgcgggcggcggcgagctgaacctgctgccgtggccgaaggtcgacttctcgaagttc
ggcccgttcgaggcgaagccgctgtcgcgcatcaagaagatctcgggcgcgaacctgcat
cgcaactgggtgatgatcccgcacgtcacgaacaacgacgaggcggacatcaccgagctc
gaagcgctgcgcgtgcaactgaacaaggagcacgagaaggcgggcgtgaagttcacgatg
ctcgcgttcgtgatcaaggcggtcgtcgccgcgctgaagaagttcccgaccttcaacgcg
agcctcgacggcgacaacctcgtgttcaagcagtactaccacatcggtttcgccgccgac
acgccgaacggcctcgtcgtgccggtgatccgcgacgcggacaagaaggggctcgtcgac
atcgcgaaggaaatggccgagctgtcgaaggccgcgcgcgaaggcaagctcaagccggac
cagatgcagggcggctgcttctcgatctcgtcgctcggcgggatcggcggcacgcacttc
acgccgatcatcaatgcgccggaagtggcgatcctcgggctgtcgcgcggccagatgaag
ccggtgtgggacggcaagcagtttgtgccgcgcctcacgctgccgctgtcgctgtcgtat
gaccatcgcgtgatcgatggcgcggaagccgcgcggttcaatgcgtatctcggcgcgttg
cttgccgatttccgtcgcatcattctttga

DBGET integrated database retrieval system