KEGG   Brucella melitensis NI: BMNI_I0328Help
Entry
BMNI_I0328        CDS       T01853                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
bmw  Brucella melitensis NI
Pathway
bmw00220  Arginine biosynthesis
bmw01100  Metabolic pathways
bmw01110  Biosynthesis of secondary metabolites
bmw01130  Biosynthesis of antibiotics
bmw01230  Biosynthesis of amino acids
Module
bmw_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:bmw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BMNI_I0328
Enzymes [BR:bmw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     BMNI_I0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N TOC159_MAD
Motif
Other DBs
NCBI-ProteinID: AEQ07956
Structure
PDB: 

Position
I:335165..336103
Genome map
AA seq 312 aa AA seqDB search
MANDNGIKHFIDLSTVPATELRAILEDAKARKARLKAGEVERPYAGKVLAMIFEKLSTRT
RVSFDVGMRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDAIMIRTTAHERMLELAE
YATVPVINALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGDGNNVLHSLVEAAARFDF
NVNIATPKGSEPKSQYIDWARANGAGIMSTTDPEKAASGADCIVTDTWVSMGQEDHARGH
NVFIPYQVNANLMAKADPKALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKAI
LAWCLQDRGLGA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgataacggtatcaaacactttatcgatctctccaccgttccggcgacggag
cttcgcgccattctggaagatgccaaggcgcgcaaggcgcgcctgaaagctggcgaagtc
gaacggccctacgccggcaaggtgctggcgatgatctttgaaaagctttccacgcgtacg
cgcgtttcctttgacgtcggaatgcgccagctcggcggcgaaacgatcatgctgacgggt
tcggaaatgcagcttggccgcagcgaaaccatcgccgacacggcgaaggttctctcacgc
tatgtggatgcgatcatgatccgcaccaccgcgcatgaacgcatgctggaactggccgaa
tatgccactgttcccgttatcaatgcgttgaccgacgacacccacccttgtcagatcatg
gcagacgttcttacatatgaggaacatcgcggcccgatcaagggcaagacctttgcctgg
atgggggatggcaacaacgtcctgcattcgcttgtggaagctgcagcgcggtttgatttc
aacgtcaatatcgcgacaccgaaaggcagtgagccgaagtcgcaatatatcgactgggcg
cgggccaacggcgcgggcatcatgtccaccaccgacccggaaaaggcggcaagcggcgca
gattgcatcgtgaccgatacatgggtgtcgatggggcaggaagatcatgcccgtggacac
aatgttttcataccatatcaggtcaatgcgaacctgatggcaaaggctgacccgaaggca
ttgttcatgcactgcctgcccgcgcatcgcggtgaggaagtgaccgatgaagtcatcgac
gggccgcaatcggtcgtgttcgatgaagcggaaaacaggctccacgcccagaaggccatt
ctggcctggtgcctgcaagaccgcggtttgggagcataa

DBGET integrated database retrieval system