KEGG   Brucella melitensis NI: BMNI_I0330Help
Entry
BMNI_I0330        CDS       T01853                                 

Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
bmw  Brucella melitensis NI
Brite
KEGG Orthology (KO) [BR:bmw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BMNI_I0330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 PUMA
Motif
Other DBs
NCBI-ProteinID: AEQ07958
Position
I:complement(337168..337560)
Genome map
AA seq 130 aa AA seqDB search
MYSAVTRGIEVTVEPFYLEVQSEPEENRYVWGYRVTIVNNSSETVQLCSRYWQITDANGH
VQEVRGSGVVGKQPVLDPGDSYQYSSGCPLTTSSGVMVGRYQMKGEDGAQFEIEIPAFSL
DVPEQRRTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatagtgcggtaacacgcgggatcgaagttacggtcgagcccttttatctggaagtc
caatccgagccggaagaaaaccgttatgtatggggttatcgcgtcacgatcgtgaacaat
tcatccgaaacggtgcagctttgctcgcgctactggcagatcaccgacgccaacggccat
gtgcaagaagtgcgcggttcaggcgtggtcggcaagcagcctgttctcgatccgggcgat
tcataccagtattcttccggttgcccgctcacaacctcgtcaggcgtgatggtcgggcgc
taccagatgaagggcgaagacggcgcacaattcgagatcgagattcccgccttttcactc
gacgtacccgaacagcgccgcacgctgaactga

DBGET integrated database retrieval system