KEGG   Brucella melitensis NI: BMNI_I0973Help
Entry
BMNI_I0973        CDS       T01853                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bmw  Brucella melitensis NI
Pathway
bmw00450  Selenocompound metabolism
bmw00970  Aminoacyl-tRNA biosynthesis
bmw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BMNI_I0973
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BMNI_I0973
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bmw01007]
    BMNI_I0973
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bmw03016]
    BMNI_I0973
Enzymes [BR:bmw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BMNI_I0973
Amino acid related enzymes [BR:bmw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BMNI_I0973
Transfer RNA biogenesis [BR:bmw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BMNI_I0973
 Prokaryotic type
   Other AARSs
    BMNI_I0973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DUF2529
Motif
Other DBs
NCBI-ProteinID: AEQ08596
Position
I:973469..975016
Genome map
AA seq 515 aa AA seqDB search
MSREKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQS
ARKEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQVIWQAMVANGDIYK
GGYAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYE
NNPGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITA
LGYPDTTDERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEK
MSKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLA
QRSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVA
EANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPAD
KRQFADVLASPLAGGTDLPAPQPVFPRYVEADEQN
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgaaaaatattacatcacgactgcgattgcttatccgaacggaaagccgcat
atcggccacgcttacgaactgatcgcgaccgatgccatggcgcggtttcagcgtctcaat
ggcatggatgtttattttctgaccggcacggacgagcatggcatcaagatgctgcaaagc
gcgcgcaaggaaggcattacgccgcgcgagctggcagaccgcaacacatccgccttccgt
cgaatggctgaagtgctgaacagctccaacgacgactatatccgcacctccgaagagcgt
cattacaaggccagccaggtcatttggcaggcgatggtcgcaaatggggatatttacaag
ggcggctatgccggctggtattccgtgcgcgacgaagcctattacggcgaggaagaaacg
gaagtgcgcgcggatggcgtccgctacggcccgcagggaacgcctgtggaatgggtggag
gaggaaagctatttcttccgtctttcggcctatcaggacaagctgctcgacctctacgag
aacaatccgggctttatcatgcccgccgaacgccgcaatgagattgtgagcttcgtgaag
tcaggtctcaaggacctgtcgatttcgcgcacgaccttcgattggggcattccggtgccg
ggagatgaaaagcacgtcatgtatgtgtgggtggatgcgctcaccaattacatcactgcg
ctcggctatcctgatacgaccgatgagcgttgggcttactggcccgccaatgcccatatc
atcggcaaggatatttcccgcttccatgcggtctattggcctgcattcctgatgtcggcc
caattacccttgccgaagcgtgttttcgcgcatgggttcctgttcaatcgcggcgagaaa
atgtcgaagtcagtcggcaatgttatcgatccgtttgaactggtggagcgttacggcctg
gaccagttgcgttatttcctgatgcgtgaagtgccattcggccaggatggcagctacagc
catgaggcgatcgtcaaccgcaccaatgccgatctggccaacgacctcggcaatcttgcc
cagcgttcgctatcgatgatcgccaagaattgcgaaggcaaggtgccgcagcccggcgca
ttttccgaggctgacaaggccattctggatcaggccgatgccgcgctcgaaaccgcgcgc
aaggcaatggacgatcaggccctgcatctggcattgggtgcgatcttcgctgttgtggcg
gaagccaaccgctattttgcggggcaggagccatgggcactgcgcaagaccgatcctgcg
cgcatgggcaccgtgctctatgtaacagccgaggttctgcgccgcgtcggcatcatggtg
cagcctttcatcccgcaatctgcggagaagctgctcgatattctggctgtcccggctgac
aagcgccagtttgccgatgtgctggcaagcccgcttgctggtgggaccgatctgcctgcg
ccgcagccggtcttcccgcgctatgtggaagcggacgaacagaactga

DBGET integrated database retrieval system