KEGG   Brucella melitensis NI: BMNI_I1034Help
Entry
BMNI_I1034        CDS       T01853                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bmw  Brucella melitensis NI
Pathway
bmw00010  Glycolysis / Gluconeogenesis
bmw00071  Fatty acid degradation
bmw00350  Tyrosine metabolism
bmw00625  Chloroalkane and chloroalkene degradation
bmw00626  Naphthalene degradation
bmw01100  Metabolic pathways
bmw01110  Biosynthesis of secondary metabolites
bmw01120  Microbial metabolism in diverse environments
bmw01130  Biosynthesis of antibiotics
bmw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMNI_I1034
  Lipid metabolism
   00071 Fatty acid degradation
    BMNI_I1034
  Amino acid metabolism
   00350 Tyrosine metabolism
    BMNI_I1034
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BMNI_I1034
   00626 Naphthalene degradation
    BMNI_I1034
Enzymes [BR:bmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BMNI_I1034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N_2 ADH_zinc_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AEQ08657
Position
I:1046393..1047376
Genome map
AA seq 327 aa AA seqDB search
MKAMVLEKPGQPLVLVERPDPLPGPGQIRLKVEACAVCRTDLHVVDGELERPKLPLVPGH
EIVGVIDAVGTGVDPSRTGRRVGVPWLGHTCGACDYCRSGAENLCDAPLFTGYTRDGGFA
THVVADADFAFDLDEAADPVALAPLLCAGLIGWRSLKKAGEGKRIGLYGFGAAAHIIAQV
CRWQDREVYAFTKPGDTEAKDFARSLGAVWAGDSDILPPSPLDAAIIFAPAGELVPAALR
AVRKGGRVVCGGIHMSDIPSMPYSILWEERALVSVANLTRNDAEEFFPLARAAGVRTHTT
IYPLESANEALADLRSGRLSGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatggtgctggagaagccgggacagccactggttctcgtggagcgccctgat
ccgttgccggggccgggccagatcaggctgaaggttgaagcctgcgccgtctgccggaca
gatttgcatgtggtggatggagagcttgaaaggccaaagctgccgctggttcccggacat
gagatcgttggcgttatcgatgccgttggaacgggcgtcgatccgtcacgcacaggacgg
cgtgtgggggttccgtggcttgggcatacttgcggcgcctgtgactattgtcgctccggc
gctgaaaacctgtgcgatgccccgctttttaccggctacacgcgcgatggcgggttcgcc
acccatgtcgtcgcagatgccgattttgctttcgatctcgatgaggccgccgatcctgtg
gctctggcgcccttgctctgcgctgggctgatcggctggcgatcgctgaagaaagcaggc
gagggcaagcgcatcggcctttatggctttggggctgccgcacacatcattgcgcaggtc
tgccgctggcaggacagggaggtttacgctttcacaaagcccggagatacggaagcgaaa
gattttgcgcgcagccttggcgcggtatgggccggagattcagatattctgccgccgtca
ccgctggatgcagctatcattttcgcacccgccggggagctcgttccagccgccttgcgt
gcggtgcgcaagggcggccgggtggtctgcggcggcatccatatgagcgatattccatcc
atgccctattcgatcctgtgggaagaacgcgcgctcgtttccgtcgcaaacctcacccgg
aacgatgcagaagagtttttcccgcttgcccgcgcggcaggcgtgcgcactcacaccaca
atctacccgcttgaaagtgcaaacgaggcgctcgccgatctgcgctccggccgcctcagc
ggggcggctgttcttgtgccatag

DBGET integrated database retrieval system