KEGG   Brucella melitensis NI: BMNI_I1556Help
Entry
BMNI_I1556        CDS       T01853                                 

Definition
(GenBank) NADP-dependent 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
bmw  Brucella melitensis NI
Pathway
bmw00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:bmw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    BMNI_I1556
Enzymes [BR:bmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     BMNI_I1556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase T4SS-DNA_transf 3HCDH_N B12-binding
Motif
Other DBs
NCBI-ProteinID: AEQ09175
Position
I:1580130..1581044
Genome map
AA seq 304 aa AA seqDB search
MGADPVYGLPGFGDHEGRTPFKRLQVSDIVAIRTPVRITPDRKAFWRKYMSYESPFHLND
AVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTD
EQHREAVIKAALDQFGKITVLVNNAGGGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAP
HMQKAGGGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGA
IKTDALATVLTPEIERAILKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGV
QELD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgacccggtttacggattacccggatttggcgaccatgaagggcgaacgccc
tttaagcgccttcaggtctcagatatagttgccatccgcacgccggtccgcatcacgccg
gatcgcaaagccttctggagaaaatatatgtcctatgagagcccgttccacctgaatgat
gctgttgcaatcgtcaccggagcggcggcaggtatcggacgggccatcgccggaaccttc
gccaaggctggtgcttcggttgtcgtaaccgaccttaaaagcgaaggcgctgaagccgtt
gcagccgcaataaggcaagctggcggcaaggccatcgggcttgaatgcaacgtaaccgac
gagcagcatcgcgaagccgtcatcaaagcggccctcgatcagttcggcaaaatcactgtt
ctggtcaacaatgcgggtggaggcggccccaagcccttcgatatgccgatgagcgacttt
gaatgggccttcaagctcaatctcttttccctgtttcgcctgtcgcaattggctgcccca
cacatgcagaaggctggcggcggcgcaattctcaatatttcgtccatggccggagaaaat
accaatgtccggatggcctcctatggttcgtccaaggcggcggtcaatcacctcacccgc
aacattgccttcgatgtcggcccaatgggcattcgcgtgaatgccatcgcacccggcgcg
atcaagaccgatgcgctcgcaaccgttctgacgcctgaaatcgaacgcgccatactcaag
cacacgccgcttggccgcctcggcgaagcgcaggatatcgccaatgcggcgctgttcctc
tgttcgcccgccgcagcatggatcagcggtcaggttctcacggtttccggcggcggcgtg
caggaactcgactga

DBGET integrated database retrieval system