KEGG   Brucella melitensis NI: BMNI_II0416Help
Entry
BMNI_II0416       CDS       T01853                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmw  Brucella melitensis NI
Pathway
bmw00071  Fatty acid degradation
bmw00072  Synthesis and degradation of ketone bodies
bmw00280  Valine, leucine and isoleucine degradation
bmw00310  Lysine degradation
bmw00362  Benzoate degradation
bmw00380  Tryptophan metabolism
bmw00620  Pyruvate metabolism
bmw00630  Glyoxylate and dicarboxylate metabolism
bmw00640  Propanoate metabolism
bmw00650  Butanoate metabolism
bmw00900  Terpenoid backbone biosynthesis
bmw01100  Metabolic pathways
bmw01110  Biosynthesis of secondary metabolites
bmw01120  Microbial metabolism in diverse environments
bmw01130  Biosynthesis of antibiotics
bmw01200  Carbon metabolism
bmw01212  Fatty acid metabolism
bmw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMNI_II0416
   00630 Glyoxylate and dicarboxylate metabolism
    BMNI_II0416
   00640 Propanoate metabolism
    BMNI_II0416
   00650 Butanoate metabolism
    BMNI_II0416
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMNI_II0416
   00072 Synthesis and degradation of ketone bodies
    BMNI_II0416
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMNI_II0416
   00310 Lysine degradation
    BMNI_II0416
   00380 Tryptophan metabolism
    BMNI_II0416
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMNI_II0416
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMNI_II0416
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMNI_II0416
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmw04147]
    BMNI_II0416
Enzymes [BR:bmw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMNI_II0416
Exosome [BR:bmw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMNI_II0416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEQ10126
Position
II:complement(415749..416939)
Genome map
AA seq 396 aa AA seqDB search
MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGAGLAPEAVEEVIMGCVL
PAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAHDLILAGSADVIVAGGMES
MTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
AFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVTIDEQPGKAKLDKIPTLRPAFRE
GGTVTAANSSSISDGAAALLLMRASEAEKRGLTPRAVITGHATYADKPNLFSTAPIGAIR
KLSEKTGWDLKDVDLFEINEAFAVVAMAAVRDLDLPHDKVNIHGGACALGHPIGASGARI
LVTLLAALETHGLKRGIAGICLGGGEATAMGIERII
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagcgatcctattgtcatcgtcggtgcttcgcgcacccccatgggcggtttt
cagggtgacttcacaaatgcgcaggcaaccgaccttggcgcttccgccatcggcggcgcg
cttgccggtgcaggccttgccccggaagccgtcgaggaggttatcatgggctgtgtcctg
cctgctggtcagggtcaggcgcctgcgcgtcaggcctcgctcaaggccgggctgccgctt
ggcaccggtgccacgaccgtcaacaagatgtgcggctcgggcatgaaggccgcgatgctt
gcccatgacctcatccttgccggttccgccgatgtcatcgtcgcgggcggcatggaaagc
atgacaaatgccccctatcttctgcccaaggcgcgcgggggctatcgcatgggccatgga
caggtgctcgaccatatgttcctcgatgggctggaagatgcctatgacaaggggcgcctg
atgggcacgtttgcggaagattgcgccgaggcctaccagttcacgcgcgaggcgcaggac
gcatttgcgatatcctccctgacccgcgcgcagaacgcgatcaaggatggtctttttgcg
gcggaaatcacgccggtcaaggtcaagtccggccgcgccgaggtggaagttaccattgac
gagcagccaggcaaggcaaagctggacaagatccccacgctgcgccccgccttccgcgaa
ggcggcacggtaacggcggccaattcctcttccatttccgatggcgcggcagcacttctg
ctcatgcgcgcatcggaggcagaaaaacgtggcctcaccccgcgcgcggtcatcaccggc
catgcaacctatgccgacaagccaaatctcttctccacggcccccattggcgcgatccgc
aaactgtctgaaaagactggctgggatttgaaggatgtcgatctcttcgagatcaatgaa
gcctttgccgttgttgccatggccgccgtgcgcgatctcgacctgccgcacgacaaggtc
aatattcatggcggcgcctgtgcacttggccaccccatcggcgcatcgggcgcacgtatt
ctcgtaaccctgctggcggcacttgaaacacatggcctgaagcgcggcatcgcgggcatc
tgccttggcggcggcgaggcaaccgcaatgggtatcgaaaggatcatctga

DBGET integrated database retrieval system