KEGG   Brucella melitensis NI: BMNI_II0990Help
Entry
BMNI_II0990       CDS       T01853                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bmw  Brucella melitensis NI
Pathway
bmw00010  Glycolysis / Gluconeogenesis
bmw00052  Galactose metabolism
bmw00500  Starch and sucrose metabolism
bmw00520  Amino sugar and nucleotide sugar metabolism
bmw00521  Streptomycin biosynthesis
bmw01100  Metabolic pathways
bmw01110  Biosynthesis of secondary metabolites
bmw01120  Microbial metabolism in diverse environments
bmw01130  Biosynthesis of antibiotics
bmw01200  Carbon metabolism
Module
bmw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMNI_II0990
   00052 Galactose metabolism
    BMNI_II0990
   00500 Starch and sucrose metabolism
    BMNI_II0990
   00520 Amino sugar and nucleotide sugar metabolism
    BMNI_II0990
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMNI_II0990
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BMNI_II0990
Enzymes [BR:bmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BMNI_II0990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AEQ10700
Position
II:1002760..1003791
Genome map
AA seq 343 aa AA seqDB search
MQAIIDAEQSFKFPVLVGDIGGTNARFSILVDSNAEPKEFPVLQTADYATIDEAIQHAIL
DQTAIQPRSVILAVAGPVDGDEIDLTNCDWVVRPKKMIADLGFEDVTVLNDFEAQALAVV
SLEGHHMEQIGGKPEEAVATRVVLGPGTGLGVAGLVCTRHAWVPVPGEGGHIDIGPRTER
DYQIFPHIERIEGRVTGEQILSGRGLRNLYLGICAADKITPTLETPVDITSAGLDGSNPQ
AAETLDLFATYLGRLAGDLALIFMAHGGVYLSGGIPVRILSALKAGSFRAAFEDKAPNKA
IMRDIPVRVITYQLAALTGLSAFARTPSRFEVSTEGRRWRMRR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgattatcgacgccgaacagagtttcaagtttccggttctcgtcggcgatatc
ggcggcaccaatgcccgtttttctatcctcgtggattcaaacgcggagccgaaggagttt
cccgtgctccagacggcggattatgccacaatagacgaagcgatccagcacgccattctg
gatcagacggccatccagccgcgctctgtcattctggccgtggcaggcccggtggacggc
gacgagatcgacctcaccaattgcgactgggtcgtgcgtcctaaaaagatgatcgctgat
ctgggctttgaagacgtgaccgtcctcaatgatttcgaggcgcaggcccttgccgtggtt
tcgctggaaggccaccatatggaacagatcggcggcaaaccggaggaggctgttgccacc
cgcgtcgtgctcggccccggcacgggccttggcgtggcaggtctggtttgcacacgtcat
gcatgggttccggttcccggtgaaggcggtcatatcgatatcggtccacgcaccgaacgc
gactaccagattttcccgcatatcgaacgcatcgaagggcgtgtcaccggcgagcaaatt
cttagcgggcggggcctgcgcaacctctatctgggcatctgcgcggccgacaagatcacg
cccacccttgagacgccagtagacattacatccgccggactggacggcagcaatccacaa
gccgcagaaacgcttgacctcttcgccacctatctggggcggcttgcgggcgaccttgcg
ctcattttcatggcgcatggcggcgtttatctttcgggtggcatcccggtgcgcatcctt
tccgccctcaaggccggttcgttccgcgcagccttcgaggacaaggccccgaacaaggcc
atcatgcgcgacataccggtccgcgttatcacatatcaactggcggccttaaccgggctt
tccgctttcgcccgcaccccctcgcgctttgaagtttcgaccgagggccgccgctggcgc
atgcgccgctag

DBGET integrated database retrieval system