KEGG   Halobacteriovorax marinus: BMS_0639Help
Entry
BMS_0639          CDS       T01659                                 

Definition
(GenBank) putative phenylacetate-coenzyme A ligase
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
bmx  Halobacteriovorax marinus
Pathway
bmx00360  Phenylalanine metabolism
bmx01100  Metabolic pathways
bmx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BMS_0639
Enzymes [BR:bmx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     BMS_0639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: CBW25546
UniProt: E1X574
Position
658071..659315
Genome map
AA seq 414 aa AA seqDB search
MKQNLREHIDFVRENSPFYKELYRDVPLKDYSISDLPILNQDDYWSKNGFENNSVLTSDL
SDGVVFKSGGTTGVPKSSFFTQEEWETFTTDFSFGMDQLRLQKGDRCANLFYSGDLYASF
LFINKSVEKLKNKVVQFPVTGQTSIEETKRIINSYKINVLFGVPTSLVSLAASFESSDNC
INQIYYGGEPLFDDQREKLQRAFPEAHISSIGYASVDGGQLGYVDKSCTAGEHIVFDKTY
MEIVDPDTNEVILEENKVGRLIYTNLSRRLMPIVRYPVGDMASWTEVGKRFSLLGRADEG
ARIGAVTVTREDIVNTAASIGEKQAISGVQLIIKRESGKDYLHVYLGVQSKENLNILNYV
HLFKESFFMQRPMYKKEKDIGNIADLKVSIVLVDELLKNPRTGKLRLVIDERFI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaaaacctaagagagcatattgattttgtaagagagaattcacctttttataag
gaactctatagggatgtccccctcaaagattatagtatttcagatcttcctattttaaat
caagatgactattggtctaagaatggatttgagaataattccgtactaacgtcagactta
agtgatggagttgtctttaaaagcggcggaacaacaggtgttccaaagtctagcttcttc
acgcaagaagagtgggagacgtttacaacggatttctcatttggaatggatcagctaaga
cttcaaaaaggggatcgttgtgcaaacctattctactctggtgatctctatgcatctttt
ttatttattaataagagtgtggaaaagttaaagaataaggttgtgcaatttccagttaca
ggtcagacaagtattgaagagacaaagagaatcataaactcttacaagataaatgttctc
tttggtgttccaacatctttagtgagcctggcagcctcatttgaatcaagtgataattgt
attaatcaaatttactatggaggagagccactttttgatgatcaaagagagaaacttcaa
agagcattcccagaggctcatatctcttctattggttatgcaagtgttgatggtggtcag
cttggatatgtcgataagagttgcacagcaggtgagcatattgtttttgataaaacttat
atggagattgtagatccagatacaaatgaagttattctagaagagaataaagttgggcgc
cttatttatacaaacttatctagaagacttatgcccatcgttcgctatccagttggtgat
atggcctcgtggacagaggtaggtaagaggttctctcttctggggagggccgacgaagga
gcgagaattggtgcggtaactgtgactcgtgaggatatagtgaatactgcggcctcaatc
ggagagaaacaggcaatttcgggggtccaattaataatcaaacgagagagtggcaaagat
tatttgcacgtctatttaggtgttcagagtaaagaaaacctaaatattttaaactacgtt
catttatttaaagagtccttttttatgcaaagacctatgtataagaaggagaaagatatt
ggaaatattgcagatttaaaagtttcaatagtattagttgacgaattattgaagaatcct
agaacgggtaaattaaggttagttatagacgaaagattcatctaa

DBGET integrated database retrieval system